KEGG   Macaca fascicularis (crab-eating macaque): 102115964
Entry
102115964         CDS       T02918                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01523  Antifolate resistance
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04062  Chemokine signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04068  FoxO signaling pathway
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04380  Osteoclast differentiation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04668  TNF signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf05010  Alzheimer disease
mcf05132  Salmonella infection
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05171  Coronavirus disease - COVID-19
mcf05200  Pathways in cancer
mcf05212  Pancreatic cancer
mcf05215  Prostate cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102115964 (CHUK)
   04014 Ras signaling pathway
    102115964 (CHUK)
   04064 NF-kappa B signaling pathway
    102115964 (CHUK)
   04668 TNF signaling pathway
    102115964 (CHUK)
   04068 FoxO signaling pathway
    102115964 (CHUK)
   04151 PI3K-Akt signaling pathway
    102115964 (CHUK)
   04150 mTOR signaling pathway
    102115964 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102115964 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102115964 (CHUK)
   04621 NOD-like receptor signaling pathway
    102115964 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    102115964 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    102115964 (CHUK)
   04625 C-type lectin receptor signaling pathway
    102115964 (CHUK)
   04660 T cell receptor signaling pathway
    102115964 (CHUK)
   04658 Th1 and Th2 cell differentiation
    102115964 (CHUK)
   04659 Th17 cell differentiation
    102115964 (CHUK)
   04657 IL-17 signaling pathway
    102115964 (CHUK)
   04662 B cell receptor signaling pathway
    102115964 (CHUK)
   04062 Chemokine signaling pathway
    102115964 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102115964 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102115964 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102115964 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102115964 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102115964 (CHUK)
   05221 Acute myeloid leukemia
    102115964 (CHUK)
   05220 Chronic myeloid leukemia
    102115964 (CHUK)
   05215 Prostate cancer
    102115964 (CHUK)
   05222 Small cell lung cancer
    102115964 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102115964 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    102115964 (CHUK)
   05161 Hepatitis B
    102115964 (CHUK)
   05160 Hepatitis C
    102115964 (CHUK)
   05171 Coronavirus disease - COVID-19
    102115964 (CHUK)
   05164 Influenza A
    102115964 (CHUK)
   05162 Measles
    102115964 (CHUK)
   05168 Herpes simplex virus 1 infection
    102115964 (CHUK)
   05163 Human cytomegalovirus infection
    102115964 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102115964 (CHUK)
   05169 Epstein-Barr virus infection
    102115964 (CHUK)
   05165 Human papillomavirus infection
    102115964 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102115964 (CHUK)
   05135 Yersinia infection
    102115964 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102115964 (CHUK)
   05142 Chagas disease
    102115964 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102115964 (CHUK)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102115964 (CHUK)
   05418 Fluid shear stress and atherosclerosis
    102115964 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102115964 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102115964 (CHUK)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102115964 (CHUK)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102115964 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 102115964
NCBI-ProteinID: XP_005566237
UniProt: A0A2K5X858 G7PDQ9
Position
9
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
VQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSVWLPPTSAEHDHSLSCVVTPQDGDTSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ttgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccac
gaaatccagattatgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggacgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtactaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtgtatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
gtacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tacagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgctattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaacatcaaagaagctgataatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacgtca
gtatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggatacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system