KEGG   Macaca fascicularis (crab-eating macaque): 102116430
Entry
102116430         CDS       T02918                                 

Gene name
IL6R
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04066  HIF-1 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04659  Th17 cell differentiation
mcf04932  Non-alcoholic fatty liver disease
mcf05163  Human cytomegalovirus infection
mcf05171  Coronavirus disease - COVID-19
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102116430 (IL6R)
   04066 HIF-1 signaling pathway
    102116430 (IL6R)
   04151 PI3K-Akt signaling pathway
    102116430 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102116430 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102116430 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102116430 (IL6R)
   04659 Th17 cell differentiation
    102116430 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102116430 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102116430 (IL6R)
   05163 Human cytomegalovirus infection
    102116430 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102116430 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102116430 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102116430 (IL6R)
   04090 CD molecules [BR:mcf04090]
    102116430 (IL6R)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL6/12 receptor family
   102116430 (IL6R)
CD molecules [BR:mcf04090]
 Proteins
  102116430 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 I-set
Other DBs
NCBI-GeneID: 102116430
NCBI-ProteinID: XP_005541720
Position
1
AA seq 697 aa
MPKPHPRPMKSESLEPRPRHWWVLGLPADSSGQPGYQALLYHKGKSHIASSRALQVCLSQ
RNPVHETKNQNKCPFLINRTGRKGSDGAGGPLFSPLRCGAVAGSHPLGRPVRGAVAPSAP
AFVTAPSDGPETLQREFLKCFPVLPGPSAALSHVRVGSLTDTETGQRERSRARRGAEGLA
VYIERRAPANGGCPRRLSQPARPPPRPCRPVPTSLSASAGPWSGSRGGSMLAVGCALLAA
LLAAPGAALAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHL
SRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV
CEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS
MCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL
RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM
GTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLPTFLVAG
GSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPP
VSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcccaagcctcaccccagaccgatgaaatcagaatctctggagccccgaccgagacat
tggtgggttttggggctcccggctgattccagtgggcaaccaggctaccaagcactgctt
tatcataagggtaagagtcacatcgcctcctcgagggctctccaggtgtgcctttcacag
cgtaatcctgttcacgaaaccaaaaatcaaaacaagtgcccttttctcatcaacagaacc
gggaggaagggctctgacggggctggcggtcccctgttctccccgctcaggtgcggcgct
gtggcaggaagccaccccctcggtcggccggtgcgcggggctgttgcgccatccgctcca
gctttcgtaaccgcaccctcggacggcccagagacgctccagcgcgagttcctcaaatgt
tttcctgtgttgccaggaccgtccgccgctctgagtcatgtgcgagtgggaagtctcact
gacactgagaccggccagagggagcggagccgagcgcggcgcggggctgagggactcgca
gtgtatatagagcgccgggctcctgcgaatgggggctgcccccggagactgagccagcct
gcccgcccaccgccccgcccctgccgcccggttcccaccagcctgtccgcctctgcggga
ccatggagcggtagccgaggaggaagcatgctggccgtcggctgcgcgctgctggctgcc
ttgctggccgcgccgggggcggcgctggccccggggggctgccctgcgcaggaggtggcg
agaggtgtgctgaccagtctgccaggagacagcgtgactctgacctgcccagggggagag
ccggaagacaatgccactgttcactgggttctcaggaagccagctgtaggctcccacctc
agcagatgggctggcgtgggaaggaggctgctgctgaggtcggtgcagctccatgactct
ggaaactattcatgctaccgggccggccgcccggctggaactgtgcacttgctggtggat
gttccccccgaggagccccagctctcctgcttccggaagagccccctcagcaacgttgtt
tgtgagtggggtcctcggagcaccccatctccgacgaccaaggctgtgctgttggtgagg
aagtttcagaacagtccggccgaagacttccaggagccgtgccagtattcccaggagtcc
cagaagttctcctgccagttggcagtcccggagggagacagctctttctacatagtgtcc
atgtgcgtcgccagtagtgtcgggagcaagctcagcaaaactcagacctttcagggttgt
ggaatcttgcagcctgatccgcctgccaacatcacagtcactgccgtggccagaaacccc
cgctggctcagtgtcacctggcaagacccccactcctggaactcatctttctacagacta
cggtttgagctcagatatcgagctgaacggtcaaagacattcacaacatggatggtcaag
gacctccagcatcactgtgtcatccacgacgcctggagcggcctgaggcacgtggtgcag
cttcgtgcccaggaggagttcgggcaaggcgagtggagcgagtggagcccggaggccatg
ggcacgccttggacagaatccaggagtcctccagctgagaacgaggtgtccacccccacg
caggcacctactactaataaagatgatgataatattctctccagagattctgcaaatgcg
acaagcctcccagtgcaagattcttcttcggtaccactgcccacattcctggttgctgga
gggagcctggcgttcggaacgctcctgtgcattgccattgttctgaggttcaagaagacg
tggaagctgcgggctctgaaggaaggcaagacaagcatgcacccgccgtattctttgggg
cagctggtcccagagaggccgcgacccaccccagtgcttgttcctctcatctccccacca
gtgtcccccagcagcctggggtctgacaacacctcgagccataaccgaccagatgccagg
gacccacggagcccttacgacatcagcaatacagactacttcttccccagatag

DBGET integrated database retrieval system