KEGG   Macaca fascicularis (crab-eating macaque): 102116805
Entry
102116805         CDS       T02918                                 

Gene name
CR1L
Definition
(RefSeq) complement C3b/C4b receptor 1 like
  KO
K04011  complement component (3b/4b) receptor 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf05134  Legionellosis
mcf05140  Leishmaniasis
mcf05144  Malaria
mcf05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102116805 (CR1L)
   04610 Complement and coagulation cascades
    102116805 (CR1L)
   04613 Neutrophil extracellular trap formation
    102116805 (CR1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102116805 (CR1L)
   05152 Tuberculosis
    102116805 (CR1L)
  09174 Infectious disease: parasitic
   05144 Malaria
    102116805 (CR1L)
   05140 Leishmaniasis
    102116805 (CR1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102116805 (CR1L)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102116805 (CR1L)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102116805 (CR1L)
CD molecules [BR:mcf04090]
 Proteins
  102116805 (CR1L)
SSDB
Motif
Pfam: Sushi Invas_SpaK
Other DBs
NCBI-GeneID: 102116805
NCBI-ProteinID: XP_015304870
Position
1
AA seq 291 aa
MAPPVRLERPFPSRRFPGLLLAALVLRLSSFSDQCNAPEQLPFXRPTNLTDASEFPVGTH
LKYECLPGYHGKPFSIICLKNSAWTSAKDKCTRKSCHNPKDPVNGMVHVIKDIQFGSQIN
YSCNKGYRLIGSSSATCIISGNTAIWDNETPICEIIPCGLPPTIANGDFFSTNREYFHYG
SVVTYRCNLGSGRKKLFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSVNRSLFSLNEVVEFRCQPGFVMKGPHRVQCQALNKWEPELPSCSRGESD
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcgcctcccgtccgcctcgagcgtccttttccttcccggcgctttcctgggttgctt
ctggcggccctggtgttgcggctgtcctccttctccgatcaatgcaatgccccagaacag
cttccatttngcaggcctaccaacctaactgatgcatctgagtttcccgttggaacacat
ctgaagtatgaatgcctccctggttatcatggaaaaccattttctatcatctgcctaaaa
aactcagcctggacaagtgctaaggacaagtgtacacgtaaatcatgtcataatcctaaa
gatcctgtgaatggcatggtgcatgtgatcaaagacatccagttcggatcccaaattaat
tattcttgtaataaaggataccgactcattggttcctcgtctgccacatgcatcatctca
ggcaatactgccatttgggataatgaaacacctatttgtgagataattccttgtgggcta
ccccccaccatcgccaatggagatttctttagcactaacagagagtattttcactacgga
tccgtggtgacctaccgctgcaatcttggaagcggaaggaaaaagctgtttgagctcgtg
ggtgagccctccatatactgcacaagcaaagatgatcaagtgggcatctggagcggcccg
gcccctcagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattg
gtgtctgtcaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcct
ggctttgttatgaaaggaccccaccgtgtgcaatgccaggccctgaacaaatgggagcca
gagttaccaagctgctccaggggtgagtctgactga

KEGG   Macaca fascicularis (crab-eating macaque): 102117401
Entry
102117401         CDS       T02918                                 

Gene name
CR1
Definition
(RefSeq) complement C3b/C4b receptor 1 (Knops blood group)
  KO
K04011  complement component (3b/4b) receptor 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf05134  Legionellosis
mcf05140  Leishmaniasis
mcf05144  Malaria
mcf05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102117401 (CR1)
   04610 Complement and coagulation cascades
    102117401 (CR1)
   04613 Neutrophil extracellular trap formation
    102117401 (CR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102117401 (CR1)
   05152 Tuberculosis
    102117401 (CR1)
  09174 Infectious disease: parasitic
   05144 Malaria
    102117401 (CR1)
   05140 Leishmaniasis
    102117401 (CR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102117401 (CR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102117401 (CR1)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102117401 (CR1)
CD molecules [BR:mcf04090]
 Proteins
  102117401 (CR1)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102117401
NCBI-ProteinID: XP_015304788
Position
1
AA seq 2400 aa
MCLGRMGASSPRSPEPVGPPAPRLPFCCGGSLLAVVVLLALPVAWGKHLQLEPFYYYFWA
PQKSSCLPRLTGNISIEVTVLVVPVQPLLTTPGQCNAPEQLPFARPTELIDESEFSIGTH
LKYECRPGYYGRPFSIICLKNSVWTSAEDKCIRKSCRNPRDPVNGMVHVIKDIQFGSQIN
YSCTEGYRLIGSSSATCIISDNTLIWDNETPICEKISCGLPPTIDNGDFFSANKEYFHYG
SVVTYHCNLGSGGRKVFELVGEPSIYCTSNEDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSVKRRLFSLNEVAEFRCQPGFVMKGPRHVQCQALNKWEPELPSCSRVCQPPPDVLHGER
TQRDKDIFQPGQEVFYICEPGYDLRGAASLRCTPQGDWSPAAPRCEVKSCDDSLGQLPNG
RVLFPRSLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIP
NGRHTGKPLEIFPFGKAVTYICDRHPDRGMTFDLIGESTIRCTSDPQGNGVWSSPAPRCG
ILGHCKAPDHFPFAKLKTQTIASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDV
CKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECVISGNTAHWSKKP
PICQRIPCGLPPAIANGDFISTNREYFHYGSVVTYRCNLGSGRKKLFELVGEPSIYCTSK
DGQVGIWSGPAPQCIIPNKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGFVMKGPRRV
QCQALNKWEPELPSCSRVCQSPPDVLHGERIQRDKDIFQPGQEVFYICEPGYDLRGAASL
RCTPQGDWSPAAPRCEVKSCDDSLGQLPNGRVLFPRSLQLGAKVDFVCDEGFQLKGSSAS
YCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPDRGM
TFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCNAPDHFLFAKLKTQTNASDFPIGTS
LKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRIN
YSCTTGHRLIGHSSAECVISGNTAHWSTKPPICQRIPCGLPPAIANGDFISTNREYFHYG
SVVTYRCNLGSGRKKLFELVGEPSIYCTSKDGQVGIWSGPAPQCIIPNKCMPPNVENGIL
VSVNRSLFSLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPSCSRVCQPPPEILHGEH
TPSHQDKFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDDFLGQLHHG
RVLVPFNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAIL
NGRHTGALLGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPQGNGVWSSPAPRCE
LSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECHPGYFGRMFSISCLENLVWSSV
EDNCRRKSCGTPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLVSGNNVTWD
KEAPICEIISCKPPPTISNGDFYSNNRTSFHSGTVVTYQCHTGPDGEQLFELMGERSIYC
TSKDDQVGVWSSPPPRCISTNKCTAPEVENGIRVPGNRSFFSLNEIVRFRCQPGFVMVGS
HTVQCQTNDRWGPKLPHCSRVCQPPPEILHGEHTPSHQDKFSPGQEVFYSCEPGYDLRGA
ASLHCTPQGDWSPEAPICTVKSCDDFLGQLLNGRVLFPLNFQLGAKVDFVCDEGFRLKGS
SASYCVLAGMESLWNSSVPVCEQIICPSPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPD
RGMTFDLIGESTIRCTSDPQGNGVWSSPATRCGILGNCKAPDNFPFAKLKTQTNASDFPI
GTSLKYECRPEYYENPFSITCLDNLVWSSPKGVCKRKSCTTPPDPVNGTVHVITDIQVGS
RINYSCTTGHRLIGHSSAECIISGNTAHWSTKPPICQRITCGLPPNITNGDFFSTNREYF
HYGSVVTYHCNLGSGGRKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIISNKCMPPNVEN
GILVSVNRSLFSLNEVVEFRCQPGFVMKGHHRVQCQALNKWEPELPSCSRVCQPPPEILH
GEHTPSHQDNFSPGQEVFYSCEPGYDLKGAASLHCTPQGDWNPEAPICTGALTLWLPDCC
FPLTWRSYSCCFIFLLVKSCDDFLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGRFAS
HCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHIGAPLGDIPYGKEVSYTCDPHPDRGM
TFNLIGESTIRCTSDPQGNGVWSSPAPRCELSVPAGANDALIVGTLSGTIFVILFIIFLS
NT seq 7203 nt   +upstreamnt  +downstreamnt
atgtgcttggggagaatgggggcctcttctccaagaagcccggagcctgttgggccgccg
gcgccccgtctccccttctgctgcggaggatccctgctggcggttgtggtgctgctcgcg
ctgccggtggcctggggtaaacatcttcaattagaacccttctattattatttttgggct
ccccagaagtcttcttgtttgcctagactcactggcaacatctcaattgaagtgacagtc
ttggttgttcctgtccagcctcttctgacaactccaggtcaatgcaatgccccggaacag
cttccatttgccaggcctaccgaactaattgatgagtctgagttttccattgggacacat
ctgaagtatgaatgtcgccctggttattatggaagaccgttttctatcatctgcctaaaa
aactcagtctggacaagtgctgaggacaagtgcatacgtaaatcatgtcgtaatcctaga
gatcctgtgaatggcatggttcatgtgatcaaagacatccagttcggatcccaaattaat
tattcttgtactgaaggataccgactcattggttcctcgtccgccacatgcatcatctca
gacaatactctcatttgggataatgaaacacctatttgtgagaaaatttcttgtgggcta
ccacccaccatagacaacggagatttctttagtgctaacaaagagtattttcactatgga
tctgtggtgacctaccactgcaatcttggaagtggagggagaaaggtgtttgagctcgtg
ggtgagccctccatatactgtaccagcaatgaagatcaagtgggcatctggagcggccca
gcccctcagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattg
gtgtctgtcaaaagacgcttattttccttaaacgaagttgcggagtttaggtgtcagcct
ggctttgtcatgaaaggaccccgccatgtgcaatgccaggccctgaacaaatgggagcca
gagttaccaagctgctccagggtatgtcagccacctccagatgtcctgcatggtgagcgt
acccaaagggacaaggacatctttcagcctgggcaggaagtgttctacatctgtgagccc
ggctatgacctcagaggggctgcgtctctgcgctgtacaccccagggagactggagccct
gcagcccccagatgtgaagtgaaatcctgtgatgactccctgggccaacttcctaatggt
cgtgtgctatttccacgtagtctccagcttggagcaaaagtggattttgtttgtgatgaa
ggatttcaattaaaaggcagctctgctagttactgtgtcttggctggaatggaaagcctt
tggaatagcagtgttccagtgtgtgaacaaatcttttgtccaagtcctccagttattcct
aatgggagacacacaggaaaacctctggaaatctttccctttggaaaagctgtaacttac
atatgtgaccgccacccagacagagggatgaccttcgacctcattggggagagcaccatc
cgctgcacaagtgaccctcaagggaatggggtttggagcagccccgcccctcgctgtgga
attctgggtcactgtaaagccccggatcattttccgtttgctaagttgaaaacccagacc
attgcatctgactttcccattgggacatctttaaagtacgaatgccgtcctgagtactac
gggaggccgttctctatcacatgtctggataacctggtgtggtcgagtcccaaagatgtc
tgtaaacgtaaatcatgtaaaactcctccagatccagtgaatggcatggtgcacgtgatc
acagacatccaggttggatccagaatcaactattcttgtactacagggcaccgactcatt
ggtcactcatctgctgaatgtgtcatctcaggcaatactgcccattggagcaagaagcca
ccaatttgtcaacgaattccttgtgggctacccccagccatcgccaatggagatttcatt
agcaccaacagagagtattttcactacggatctgtggtgacctaccgctgcaatcttgga
agcggaaggaaaaagctgtttgagctcgtgggtgagccctccatatactgcaccagcaaa
gatggccaagtgggcatctggagcggcccggcccctcagtgcattatacctaacaaatgt
acgcctccaaatgtggaaaatggaatattggtgtctgtcaacagaagcttattttcctta
aatgaagttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtg
caatgccaggccctgaacaaatgggagccagagttaccaagctgctccagggtatgtcag
tcacctccagatgtcctgcatggtgagcgtatccaaagggacaaggacatctttcagcct
gggcaggaagtgttctacatctgtgagcccggctatgacctcagaggggctgcgtctctg
cgctgtacaccccagggagactggagccctgcagcccccagatgtgaagtgaaatcctgt
gatgactccctgggccaacttcctaatggtcgtgtgctatttccacgtagtctccagctt
ggagcaaaagtggattttgtttgtgatgaaggatttcaattaaaaggcagctctgctagt
tactgtgtcttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaa
atcttttgtccaagtcctccagttattcctaatgggagacacacaggaaaacctctggaa
gtctttccctttggaaaagctgtaacttacacatgtgacccccacccagacagagggatg
accttcgacctcattggggagagcaccatccgctgcacaagtgaccctcaagggaatggg
gtttggagcagccccgcccctcgctgtggaattctgggtcactgtaatgccccggatcat
tttctgtttgctaagttgaaaacccaaaccaatgcatctgactttcccattgggacatct
ttaaagtacgaatgccgtcctgagtactacgggaggccgttctctatcacatgtctggat
aacctggtgtggtcgagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctcca
gatccagtgaatggcatggtgcacgtgatcacagacatccaggttggatccagaatcaac
tattcttgtactacagggcaccgactcattggtcactcatctgctgaatgtgtcatctca
ggcaatacagcccattggagcacgaagccgccaatttgtcagcgaattccttgtgggcta
cccccagccatcgccaatggagatttcattagcaccaacagagagtattttcactacgga
tctgtggtgacctaccgctgcaatcttggaagcggaaggaaaaagctgtttgagctcgtg
ggtgagccctccatatactgcaccagcaaagatggccaagtgggcatctggagcggcccg
gcccctcagtgcattatacctaacaaatgcatgcctccaaatgtggaaaatggaatattg
gtatctgtcaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcct
ggctttgtcatgaaaggaccccgccgtgtgcaatgccaggccctgaacaaatgggagcca
gagttaccaagctgctccagggtgtgtcagccacctccagaaatcctgcatggtgagcat
accccaagtcatcaggacaaattttcacctgggcaggaagtgttctacagctgtgagccc
ggctatgacctcagaggggctgcgtctctgcactgcacgccccagggagactggagccct
gaagcccccagatgtgcagtgaaatcctgtgatgacttcttgggtcaactccatcatggc
cgtgtgctagttccatttaatctccagcttggggcaaaggtgtcctttgtctgtgatgaa
gggtttcgcttaaagggcagctccgttagtcattgtgtcttggttggaatgagaagcctt
tggaataacagtgttcctgtgtgtgaacatatcttttgtccaaatcctccagctatcctt
aatgggagacacacaggagctctccttggagatattccctatggaaaagaaatatcttac
acatgtgacccccacccagacagagggatgaccttcaacctcattggggagagcaccatc
cgctgcacaagtgaccctcaagggaatggggtttggagcagccccgcccctcgctgtgaa
ctttctgttcgtgctggtcactgtaaaaccccagagcagtttccatttgccagtcctaca
atcccaattaatgactttgagtttccagtcgggacatctttgaattatgaatgccatcct
gggtattttgggagaatgttctctatctcctgcctagaaaacttggtctggtcaagtgtt
gaagacaactgtagacgaaaatcatgtggaactcctccagaacccttcaatggaatggtg
catataaacacagatacccagtttggatcaacagttaattattcttgtaatgaagggttt
cgactcattggttccccatctactacttgtctcgtctcaggcaataatgtcacgtgggat
aaggaggcacctatttgtgagatcatatcttgtaagccacctccaaccatatccaatgga
gacttctacagcaacaacagaacatcttttcacagtggaacagtggtaacttaccagtgc
cacactggaccagatggagaacagctgtttgagctcatgggagaacggtcaatatattgc
accagcaaagatgatcaagttggtgtttggagcagccctccccctcgatgtatttctact
aataaatgcacagctccagaagttgaaaacggaattagagtaccaggaaataggagtttc
ttttccctcaatgagatcgtgagatttagatgtcagcccggctttgtcatggtagggtcc
cacactgtgcagtgccagaccaacgacagatgggggcccaagctgccacactgctccagg
gtgtgtcagccgcctccagaaatcctgcatggtgagcatactccaagccatcaggacaaa
ttttcacctgggcaggaagtgttctacagctgtgagcccggctatgacctcagaggggct
gcgtctctgcattgcacgccccagggagactggagccctgaagcccccatatgtacagtg
aaatcctgtgatgacttcctgggccaacttcttaatggccgtgtgctatttccacttaat
ttccagcttggagcaaaagtggattttgtttgtgatgaaggatttcgattaaaaggcagc
tctgctagttactgtgtcttggctggaatggaaagcctttggaatagcagtgttccagtg
tgtgaacaaatcatttgtccaagtcctccagttattcctaatgggagacacacaggaaaa
cctctggaagtctttccctttggaaaagctgtaacttacacatgtgacccccacccagac
agagggatgaccttcgacctcattggggagagcaccatccgctgcacaagtgaccctcaa
gggaatggggtttggagcagccctgccactcgctgtggaattctgggtaactgtaaagcc
ccagataattttccatttgctaagttgaaaacccaaaccaatgcatctgactttcccatt
gggacatctttaaagtacgaatgccgtcctgagtactacgagaatccattctctatcaca
tgtctagataacctggtgtggtcgagtcccaaaggtgtctgtaaacgtaaatcatgtaca
actcctccagatccagtgaatggcacagtgcatgtgatcacagacatccaggttggatcc
agaatcaactattcttgtactacagggcaccgactcattggtcactcatctgctgaatgt
atcatctcaggcaatactgcccattggagcacgaagccgccaatttgtcaacgaattact
tgtgggctaccccccaacatcaccaatggagatttcttcagcactaacagagagtatttt
cactatggatctgtggtgacctaccactgcaatcttggaagcggagggagaaaggtgttt
gagctcgtgggtgagccctctatatactgcaccagcaaagatgaccaagtgggcatctgg
agcggcccggcccctcagtgcattatatctaacaaatgtatgcctccaaatgtggaaaat
ggaatattggtgtctgtcaacagaagcttattttccttaaatgaagttgtggagtttagg
tgtcagcctggctttgtcatgaaaggacaccaccgtgtgcaatgccaggccctgaacaaa
tgggagccagagttaccaagctgctccagggtgtgtcagccgcctccagaaatcctgcat
ggtgagcacactccaagccatcaggacaacttttcacctgggcaggaagtgttttacagc
tgtgagcccggctatgacctcaaaggggctgcgtctctgcactgcacgccccagggagac
tggaaccctgaagcccccatatgtacaggtgccttgactctctggcttccagattgctgt
ttccccctcacatggaggtcttactcctgttgttttatttttcttctagtgaaatcctgt
gatgacttcctgggccaacttcctcatggccgtgtgctgtttccactcaatctccagctt
ggagcaaaggtgtcctttgtttgcgatgaagggttccgattaaaaggcaggtttgctagt
cattgtgtcttggctggaatgaaagccctttggaatagcagtgttccagtgtgtgaacaa
atcttttgcccaaatcctccagctatccttaatgggagacacataggagctccccttgga
gatattccctatggaaaagaagtatcttacacatgcgacccccacccagacagagggatg
accttcaacctcattggggagagcaccatccgctgcacaagtgaccctcaagggaatggg
gtttggagcagccccgcccctcgctgtgaactttctgttcctgctggtgcaaatgatgct
cttatagttggcactttatccggtacgatcttcgttattttattcatcattttcctctct
tga

DBGET integrated database retrieval system