KEGG   Macaca fascicularis (crab-eating macaque): 102117108
Entry
102117108         CDS       T02918                                 

Gene name
FCER2
Definition
(RefSeq) Fc fragment of IgE receptor II
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
mcf05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102117108 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102117108 (FCER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102117108 (FCER2)
   04091 Lectins [BR:mcf04091]
    102117108 (FCER2)
CD molecules [BR:mcf04090]
 Proteins
  102117108 (FCER2)
Lectins [BR:mcf04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    102117108 (FCER2)
SSDB
Motif
Pfam: Lectin_C CENP-F_leu_zip UL45 UPF0242 PTRF_SDPR DUF4763 DUF4428 Exonuc_VII_L TPD52 DUF4530 Choline_kinase
Other DBs
NCBI-GeneID: 102117108
NCBI-ProteinID: XP_005587832
UniProt: A0A2K5WR58
Position
19
AA seq 243 aa
MEEGQYSEIEELPRKRCCRRGTQIMLLGLLTAALWAGLLTLLLLWHWDTTQHLKQLEERA
AQNVSQVSKNLERQHGDQMAQKSQSTQIWQDLEELRAEQQRLKSQDSELSWNLNGLQADL
SSFKSQELNERNTASDLLERLREEVTKLWMELQVSNGFVCNTCPEKWINFQRKCYYFGKG
TKQWLHARYACEDMEGQLVSIHSPEEQDFLTKHASHTISWIGLRNLNLKGEFIWVDGSPV
DYR
NT seq 732 nt   +upstreamnt  +downstreamnt
atggaggaaggtcaatattcagagatcgaggagcttcccaggaagcggtgttgcaggcgc
gggactcagatcatgctgctggggctgctgaccgctgctctgtgggccgggctgctgact
ctccttctcctgtggcactgggacaccacacagcatctaaaacagctggaagagagggct
gcccagaacgtctctcaagtttccaagaacttggaaagacagcacggtgaccagatggcg
cagaaatcccagtccactcagatttggcaggacctggaggaacttcgagctgaacaacag
agattgaaatctcaggactcggagctgtcctggaacctgaacgggcttcaagcagatctg
agcagcttcaagtcccaggaattgaacgagaggaacacagcttcagatttgctggaaaga
ctccgagaggaggtgacgaagctatggatggagctgcaggtgtccaatggctttgtgtgc
aacacgtgccctgaaaagtggatcaatttccaacggaagtgctactacttcggcaagggc
accaagcagtggctccacgcccggtacgcctgtgaggacatggaagggcagctggtcagc
atccacagcccggaggagcaggacttcctgaccaagcatgccagccacaccatctcctgg
attggccttcggaacttgaacctgaagggggagtttatctgggtggacgggagccccgtg
gactacaggtga

DBGET integrated database retrieval system