KEGG   Macaca fascicularis (crab-eating macaque): 102117577
Entry
102117577         CDS       T02918                                 

Gene name
CD37
Definition
(RefSeq) CD37 molecule
  KO
K06475  CD37 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102117577 (CD37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102117577 (CD37)
   04090 CD molecules [BR:mcf04090]
    102117577 (CD37)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102117577 (CD37)
CD molecules [BR:mcf04090]
 Proteins
  102117577 (CD37)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 102117577
NCBI-ProteinID: XP_005589942
UniProt: A0A2K5V5D2
Position
19
AA seq 281 aa
MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
LAISGVFTMGLALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLQ
DIVEKTIQKYHTNPEETAAEESWDYVQFQLRCCGWHSPQDWFQVLTLRGNGSEAHRVPCS
CYNLSATNDSTILDKVILPQLSRLGQLARSRHSTDICAVPANSHIYREGCARSLQKWLHN
NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcggcccaggagagctgcctcagcctcatcaaatacttcctcttcgttttcaacctc
ttcttcttcgtcctgggcagcctgatcttctgcttcggcatctggatcctcatcgacaag
accagcttcgtgtcctttgtgggcttggccttcgtgcccctgcagatctggtccaaagtc
ctggccatctctggagtcttcaccatgggcctcgccctcctgggttgtgtgggggccctc
aaggagctccgctgcctcctgggcctgtattttgggatgctgctgctcctgtttgccaca
cagataaccctgggaatcctcatctccactcagcgggcccagctggagcgaagcttgcag
gacatcgtagagaaaaccatccaaaagtaccacaccaaccccgaggagaccgcggccgag
gagagctgggactatgtgcagttccagctgcgctgttgcggctggcactccccgcaggac
tggttccaggtcctcaccctgagaggtaacgggtcggaggcgcaccgcgtgccctgctcc
tgctacaacttgtcagcgaccaacgactccacaatcctggataaggtgatcttgccccag
ctcagcaggcttggacagctggcgcggtccagacacagtacagacatctgcgcggtccct
gcaaacagccacatctaccgcgagggctgcgcgcggagcctccagaagtggctgcacaac
aaccttatttccatagtgggcatttgcctgggcgtcggcctactcgagctcgggttcatg
acgctctcgatattcctgtgcagaaacctggaccacgtctacaaccggctcgctcgatac
cgctag

DBGET integrated database retrieval system