KEGG   Macaca fascicularis (crab-eating macaque): 102117580
Entry
102117580         CDS       T02918                                 

Gene name
CD33
Definition
(RefSeq) CD33 molecule
  KO
K06473  CD33 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102117580 (CD33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102117580 (CD33)
   04091 Lectins [BR:mcf04091]
    102117580 (CD33)
CD molecules [BR:mcf04090]
 Proteins
  102117580 (CD33)
Lectins [BR:mcf04091]
 I-type lectins (Siglecs)
  102117580 (CD33)
SSDB
Motif
Pfam: V-set ig C2-set_2
Other DBs
NCBI-GeneID: 102117580
NCBI-ProteinID: XP_005590138
UniProt: A0A2K5W2R5
Position
19
AA seq 379 aa
MDGEHLKGRNQGAQETSASDMPLLLLPLLWAGALAMDPRVRLEVQESVTVQEGLCVLVPC
TFFHPVPYHTRNSPVHGYWFREGAIVSLDSPVATNKLDQEVQEETQGRFRLLGDPSRNNC
SLSIVDARRRDNGSYFFRMEKGSTKYSYKSTQLSVHVTDLTHRPQILIPGALDPDHSKNL
TCSVPWACEQGTPPIFSWMSAAPTSLGLRTTHSSVLIITPRPQDHGTNLTCQVKFPGAGV
TTERTIQLNVSYASQNPRTDIFLGDGSGKQGVVQGAIGGAGVTVLLALCLCLIFFTVKTH
RRKAARTAVGRIDTHPATGPTSSKHQKKSKLHGATETSGCSGTTLTVEMDEELHYASLNF
HGMNPSEDTSTEYSEVRTQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggatggggaacatctcaagggcaggaatcagggagcccaggaaacctcagcctcagac
atgccgctgctgctgctgcccctgctgtgggcaggggccctggctatggatccaagagtc
aggctggaagtgcaggagtcagtgacagtacaggagggtttgtgcgtccttgtgccctgc
actttcttccatcccgtaccctaccacaccaggaattccccagttcatggttactggttc
cgggaaggagccattgtatccttggactctccagtggccacaaacaagctagatcaagaa
gtacaggaggagacccagggccgattccgcctccttggggatcccagtaggaacaactgc
tccctgagcatcgtagatgccaggaggagggataacggttcatacttctttcggatggag
aaaggaagtaccaaatacagttacaaatctacccagctctctgtgcatgtgacagacttg
acccacaggccccaaatcctcatccctggagccctagaccctgaccactccaaaaacctg
acctgctctgtgccctgggcctgtgagcagggaacacctccaatcttctcctggatgtca
gctgcccccacctccctgggcctcaggaccactcactcctcggtgctcataatcacccca
cggccccaggaccacggcaccaacctcacctgtcaggtgaagttccctggagctggcgtg
accacggagagaaccatccagctcaatgtctcctatgcttcacagaacccaagaactgat
atcttcctaggagatggctcagggaaacaaggagtggttcagggagccatcgggggagct
ggtgtcacagtcctgctcgctctttgtctctgcctcatcttcttcacagtgaagactcac
aggaggaaagcagccaggacagcagtgggcaggatcgacacccaccccgccacagggcca
acatcctcgaaacaccagaagaagtccaagttacatggcgccactgaaacctcaggctgt
tcaggtaccacccttactgtggagatggatgaggagctgcactacgcttccctcaacttt
catgggatgaatccttctgaggacacctccaccgaatactcagaggtcaggacccagtga

DBGET integrated database retrieval system