KEGG   Macaca fascicularis (crab-eating macaque): 102117791
Entry
102117791         CDS       T02918                                 

Gene name
ITGB3
Definition
(RefSeq) integrin subunit beta 3
  KO
K06493  integrin beta 3
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04015  Rap1 signaling pathway
mcf04145  Phagosome
mcf04151  PI3K-Akt signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf04919  Thyroid hormone signaling pathway
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102117791 (ITGB3)
   04151 PI3K-Akt signaling pathway
    102117791 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102117791 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102117791 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102117791 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102117791 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102117791 (ITGB3)
   04611 Platelet activation
    102117791 (ITGB3)
   04613 Neutrophil extracellular trap formation
    102117791 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102117791 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102117791 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102117791 (ITGB3)
   05205 Proteoglycans in cancer
    102117791 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102117791 (ITGB3)
   05163 Human cytomegalovirus infection
    102117791 (ITGB3)
   05165 Human papillomavirus infection
    102117791 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102117791 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    102117791 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102117791 (ITGB3)
   05414 Dilated cardiomyopathy
    102117791 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102117791 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102117791 (ITGB3)
   04515 Cell adhesion molecules [BR:mcf04515]
    102117791 (ITGB3)
   04090 CD molecules [BR:mcf04090]
    102117791 (ITGB3)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102117791 (ITGB3)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102117791 (ITGB3)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin beta subunits
   102117791 (ITGB3)
CD molecules [BR:mcf04090]
 Proteins
  102117791 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 102117791
NCBI-ProteinID: XP_005584667
UniProt: G7PV32 A0A2K5WYN9
Position
16
AA seq 788 aa
MRAQPGPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLSLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSRHCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgcgagcgcagcccgggccccggccgctctgggcaactgtgctggcgctgggggcgctg
gcgggcgttggcgtcggagggcccaacatctgtaccacacgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccggaatccatc
gagttcccagtcagtgaggcccgagtactagaggacaggcccctcagcgacaaaggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggacgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
tcgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcgcacttgctggtgtttaccactgatgccaagact
catatagcactggacggaaggctggcaggcattgtccagcccaatgatgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctctcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagtcggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgctctaaa
gtcgagctggaagtgcgtgacctccctgaagaattgtctctatccttcaacgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgcccccaggagaaggagaagtccttt
accatcaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgcgac
tgtgcctgccaggcccaagctgaacctaatagccgtcactgcaacaatggcaatgggacc
tttgagtgtggggtgtgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgagtgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgtctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgcaccacacgtactgatacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccctacctgcccagatgcctgcacctttaagaaagaatgc
gtagagtgtaagaagtttgaccggggagccctacatgatgaaaatacctgcaaccgttac
tgccgcgatgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagactctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctgtcagtgatgggggccattctgctcatcggccttgccactctgctcatc
tggaagctcctcatcaccatccacgaccgaaaagagtttgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacctaccggggcacttaa

DBGET integrated database retrieval system