KEGG   Macaca fascicularis (crab-eating macaque): 102118349
Entry
102118349         CDS       T02918                                 

Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102118349
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102118349
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102118349
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102118349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102118349
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102118349
SSDB
Motif
Pfam: IL11 CLZ DUF4763
Other DBs
NCBI-GeneID: 102118349
NCBI-ProteinID: XP_005595839
UniProt: P20808
Position
Un
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQL
KDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLK
TLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtt
gcccctgggccaccacctggctcccctcgagcttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggaggacacgcggcagctgactatacagctg
aaggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agcgcgggggcactgggagctctacagctcccgagtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcatgtgcagtggctgcgtcgggcaatgggctcttccctgaag
accctggagcctgagctgggcaccctgcagacccggctggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagctgcccccagacccgccggcgcccccg
ctggcgcccccctcctcaacctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgagggggctactgctgctgaagactcggctgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102128313
Entry
102128313         CDS       T02918                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102128313 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102128313 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102128313 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102128313 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102128313 (IL11)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102128313 (IL11)
SSDB
Motif
Pfam: IL11 CLZ DUF4763
Other DBs
NCBI-GeneID: 102128313
NCBI-ProteinID: XP_015300293
UniProt: P20808
Position
Un
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQL
KDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLK
TLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtt
gcccctgggccaccacctggctcccctcgagcttccccagaccctcgggccgagctggat
agcaccgtgctcctgacccgctctctcctggaggacacgcggcagctgactatacagctg
aaggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agcgcgggggcactgggagctctacagctcccgagtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcatgtgcagtggctgcgtcgggcaatgggctcttccctgaag
accctggagcctgagctgggcaccctgcagacccggctggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagctgcccccagacccgccggcgcccccg
ctggcgcccccctcctcaacctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgagggggctactgctgctgaagactcggctgtga

DBGET integrated database retrieval system