KEGG   Macaca fascicularis (crab-eating macaque): 102118491
Entry
102118491         CDS       T02918                                 

Gene name
MS4A1
Definition
(RefSeq) membrane spanning 4-domains A1
  KO
K06466  B-lymphocyte antigen CD20
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102118491 (MS4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcf02000]
    102118491 (MS4A1)
   04090 CD molecules [BR:mcf04090]
    102118491 (MS4A1)
Transporters [BR:mcf02000]
 Other transporters
  Pores ion channels [TC:1]
   102118491 (MS4A1)
CD molecules [BR:mcf04090]
 Proteins
  102118491 (MS4A1)
SSDB
Motif
Pfam: CD20 CM2
Other DBs
NCBI-GeneID: 102118491
NCBI-ProteinID: NP_001274241
UniProt: M4ZHZ6
Position
14
AA seq 297 aa
MTTPRNSVNGTFPAEPMKGPIAMQPGPKPLLRRMSSLVGPTQSFFMRESKALGAVQIMNG
LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN
SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRVHTPYINIYNCEPANPSEKNSPST
QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWRRTCSRPKSSVVLLSAEEKKEQVI
EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
NT seq 894 nt   +upstreamnt  +downstreamnt
atgacaacacccagaaattcagtaaatgggactttcccagcagagccaatgaaaggccct
attgctatgcaacctggtccaaaaccactcctcaggaggatgtcttcactggtgggtccc
acgcaaagcttcttcatgagggaatctaaggctttgggggctgtccagattatgaatggg
ctcttccacattgccctggggggtcttctgatgatcccagcagggatctatgcacccatc
tgtgtgactgtgtggtaccctctgtggggaggcattatgtatattatttccggatcactg
ctggcagcaacggagaaaaactccaggaagtgtttggtcaaaggaaaaatgataatgaat
tcattgagcctctttgctgccatttctggaatgattctttcaatcatggacatacttaat
attaaaatttcccattttttaaaaatggagagtctgaattttattagagttcacacacca
tatattaacatatacaactgtgaaccagctaatccctctgagaaaaactctccatctact
caatactgttacagcatacaatctctgttcctgggcattttgtcagtgatgctgatcttt
gccttcttccaggaacttgtaatagctggcatcgttgagaatgaatggagaagaacatgc
tccagacccaaatctagcgtagttctcctgtcagctgaagaaaaaaaagaacaagtcatt
gaaataaaagaagaagtggttgggctaactgaaacatcttcccaaccaaagaatgaagaa
gacattgaaattattccaatccaagaagaggaagaagaagaaacagagacaaactttcca
gaacctccccaagatcaggaatcttcaccaatagaaaatgacagctctccttaa

DBGET integrated database retrieval system