KEGG   Macaca fascicularis (crab-eating macaque): 102118691
Entry
102118691         CDS       T02918                                 

Gene name
GP1BB
Definition
(RefSeq) glycoprotein Ib platelet beta subunit
  KO
K06262  platelet glycoprotein Ib beta chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102118691 (GP1BB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102118691 (GP1BB)
   04611 Platelet activation
    102118691 (GP1BB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102118691 (GP1BB)
CD molecules [BR:mcf04090]
 Proteins
  102118691 (GP1BB)
SSDB
Motif
Pfam: LRRNT LRRCT LRR_8
Other DBs
NCBI-GeneID: 102118691
NCBI-ProteinID: XP_015312917
Position
10
AA seq 241 aa
MPGIRGWMEPGRRSGYSETSPRCPADRPAHCGASLAGPRGALSLLLLMLAPPSRPAADCP
APCSCAGTLVDCGRRGLTWASLPTSFPVHTTELVLTGNNLTALPSGLLDALPALRTAHLG
ANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC
WGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARARAALRLSLTDPLVAEQDGTDE
S
NT seq 726 nt   +upstreamnt  +downstreamnt
atgccgggcatcaggggctggatggagccgggccggcgctctgggtactcagagacgtcg
cccaggtgccccgccgaccgcccggctcactgcggcgcttcccttgcagggccgcgcggg
gcgctgagcttactgctcctgatgctggcgccgccgagccgcccggccgcagattgcccg
gcgccctgtagctgcgcggggacgctcgtggactgcgggcgccgggggctgacttgggcc
tcgctgccgacctcctttcctgtccacacaaccgagctggtgctgaccggcaacaacctg
acggcgctgccgtcggggctgctggacgcgctgcccgcgctgcgcaccgcacacctgggc
gccaacccctggcgctgcgactgccgccttgtgccgctgcgcgcctggctggccggccgc
cccgagcgtgcgccctaccgcgacctgcgttgcgtggcgcccccagcgctgcgcggccgc
ctgctgccctacctagccgaggacgagctgcgcgccgcttgtgctcccggcccgctctgc
tggggggcgctggcggcgcagcttgcgttgctgggccttgggctgctgcacgcgttgctg
ctggtgctgctgctgtgccgcctgcggaggctgcgcgcccgcgcccgcgctcgcgcccgc
gcggcactccggctgtcgctgaccgacccactggtggccgagcaagacggaaccgacgag
tcctga

KEGG   Macaca fascicularis (crab-eating macaque): 102135994
Entry
102135994         CDS       T02918                                 

Gene name
GP1BA
Definition
(RefSeq) glycoprotein Ib platelet alpha subunit
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102135994 (GP1BA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102135994 (GP1BA)
   04611 Platelet activation
    102135994 (GP1BA)
   04613 Neutrophil extracellular trap formation
    102135994 (GP1BA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102135994 (GP1BA)
CD molecules [BR:mcf04090]
 Proteins
  102135994 (GP1BA)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9
Other DBs
NCBI-GeneID: 102135994
NCBI-ProteinID: XP_015292989
Position
16
AA seq 644 aa
MPLLLLLLLLPSPLRPHPICEVSKVASHLEVNCDKSNLRALPPDLPKDTTILHLGENLLY
TFSLASLVPFTRLTQLYLDKCELTKLQVDGTLPVLGTLDLSHNKLQSLPLLGQSLPALTI
LDVSFNQLTSLPLGALHGLGKLQELYLKGNELKTLPPGLLTPTPKLEKLSLANNHLTQLP
AGLLDGLGNLDTLLLQENSLYTIPKGFFGFHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKTPVYKYPGKGCPTLGDEDDPGLYDDYTDEDA
EGDAVRATRTVVKFSTKAHTTPWGLFHSWSAASLDGQTPSSLHPTQESTKEQTTFPPRWT
PDFTLHMGSATFSKTPKSTTELTLSPTTSEPTPKPSPSPTTLEPTPSPTTPEPTPTQTTP
EPTPSPTTPEPTPTQTTPELSPSPITPELATSPTIPESATSLITPKSIIFLTTTKPVSLL
ESTKKNIPEFDQQPKLRGVLQGHFESYRNDPFLHPDFCCLLPLGFYVLGLLWLLFASVVL
ILMLTWVRHVKPHALDSGQGAPLATATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSS
LFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLGTVSIRYSGHSL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgcctctcctcctcttgctgctcctgctgccaagccccttacgtccccaccccatctgt
gaggtctccaaagtggccagccacctagaagtgaactgtgacaagagcaatctgagagcg
ctgcctccagacctgccaaaagacacgacaatcctccacttgggggagaacctcctgtac
accttctccctggcatccctggtgcctttcactcgcctcactcagctgtacttagataag
tgcgagctcaccaagctccaggtcgatgggacactgccagtgctggggaccctggatcta
tcccacaataagctgcaaagcctgcccttgctagggcagtcactgcctgctctcaccatc
ctggacgtctccttcaaccagctgacctcgctgcctcttggtgccctgcatggtcttggc
aaactccaagagctctacctgaaaggcaatgagctgaagaccctgcccccagggctcctg
acgcccacacccaagctggagaagctcagcctggctaacaaccacttgacccagctcccc
gccgggctcctggatgggctggggaatctcgacacccttctcctccaagagaactcgctg
tatacgataccaaagggcttttttgggttccacctcctgccttttgcttttctccatggg
aacccctggttatgcaactgtgagatcctctattttcgtcgctggctgcaggacaatgcc
gaaaatgtctacgtgtggaagcaaggtgtggacgtcaaggccatgacctctaacgtggcc
agtgtgcagtgtgacaattcagacaagactcctgtctacaaatacccgggaaagggatgc
cccacccttggtgatgaagatgacccaggcctatatgatgactacacagacgaggacgct
gagggtgatgcggtgcgtgccacaaggactgtggtcaagttctccaccaaagcccatacg
actccctggggtctgttccactcatggtctgctgcttctctagacggtcaaacgccctcc
tccttgcatccaacacaagaatccactaaggagcagaccacattcccacccagatggacc
ccagatttcacacttcacatgggatctgccacattctccaaaactccaaaatccactact
gaactgaccctaagcccgaccacctcagagcccaccccaaagccctccccaagcccaacc
accctggagcccaccccaagcccgaccaccccagagcccaccccaactcagaccacccca
gagcccaccccaagcccaaccaccccagagcccactccaactcagaccaccccagagctc
tccccaagcccgatcaccccagagctggccacaagcccgaccatcccggagtccgccaca
agcctgatcactccaaaaagcatcatatttttgactaccacaaaacccgtatcactctta
gaatccaccaaaaaaaacatccctgaatttgatcagcaaccaaagctccgtggggtgctc
caagggcatttcgagagctacagaaatgacccttttctccaccccgacttttgctgcctc
ctccccctgggcttctatgtcttgggtctcctctggctgctctttgcctctgtggtcctc
atcctgatgctgacctgggtcaggcatgtgaaaccacacgccctggactctggccaaggt
gctcctctggccacagccacacaaaccacacatctggagctgcagaggggacggcaagtg
acggtgccccgggcctggcttctcttccttcgaggctcactccccactttccgctccagc
ctcttcctgtgggtacggcctaatggccgtgtggggcctctagtggcaggaaggaggccc
tcagctctgagtcagggtcgtggtcaggacctgctgggcacagtgagcattaggtactct
ggccacagcctctga

KEGG   Macaca fascicularis (crab-eating macaque): 102137361
Entry
102137361         CDS       T02918                                 

Gene name
GP9
Definition
(RefSeq) glycoprotein IX platelet
  KO
K06263  platelet glycoprotein IX
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102137361 (GP9)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102137361 (GP9)
   04611 Platelet activation
    102137361 (GP9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102137361 (GP9)
CD molecules [BR:mcf04090]
 Proteins
  102137361 (GP9)
SSDB
Motif
Pfam: LRRNT LRR_8 LRR_4 LRRCT LRR_9
Other DBs
NCBI-GeneID: 102137361
NCBI-ProteinID: XP_005571801
UniProt: G7PIN6 A0A2K5UDB1
Position
11
AA seq 177 aa
MPAWEALFLLWATAEATKDCPIPCTCRALETMGLWVDCRGRGLTALPTLPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGQLTGYQLGSCGWQLQASWVRSGVLWDVALVAVAALGLALLAGLLCATTEALD
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcctgcctgggaagccctgttcctgctctgggccacagcagaggccaccaaggactgc
cctatcccatgcacctgccgcgccctggaaaccatggggctgtgggtggactgcaggggc
cgcgggctcacggccctgcctaccctgccagcccgcacccgccacctcctgctggccaac
aacagccttcagtccgtgcccccgggagccttcgaccacctgccccagctgcagaccctc
gatgtgacgcagaacccgtggcactgtgactgcagcctcacctatctgcgcctctggctg
gaggaccgcacacccgaggccctgctgcaggtccgctgcgccagccccagcctcgctgcc
catggcccgctgggccagctgacaggctaccagctgggcagctgcggctggcagctgcag
gcgtcctgggtgcgctcaggggtcttgtgggacgtggcactggtcgccgtggctgcgctg
ggcctggctcttctggctggcctgctgtgtgccaccactgaggccctggattga

KEGG   Macaca fascicularis (crab-eating macaque): 102143729
Entry
102143729         CDS       T02918                                 

Gene name
GP5
Definition
(RefSeq) glycoprotein V platelet
  KO
K06260  platelet glycoprotein V
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102143729 (GP5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102143729 (GP5)
   04611 Platelet activation
    102143729 (GP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102143729 (GP5)
CD molecules [BR:mcf04090]
 Proteins
  102143729 (GP5)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRCT LRR_1
Other DBs
NCBI-GeneID: 102143729
NCBI-ProteinID: XP_015300400
Position
2
AA seq 570 aa
MLRRTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSGGDVARIAALGLPTNLTHILLFGM
GRGVLQNQSFSGMTVLQRLMLSDSHISAVAPGAFNDLVKLKTLRLSRNKITHLPGALLDK
TVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPAGLFTNLGNLKLLDLSGN
NLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQLHRNHIRSITPGAFDR
LPNLSSLTLSRNHLAFLPSALFLHSHSLTLLTLFENPLAELPGVLFGEMGGLQELWLNRT
QLRTLPVAAFRNLSRLRSLGVTLSPRLSALPQGAFQGLGELRVLSLHSNGLTALPDGLLR
GLGRLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDAFGALPRLKEVLLGH
NPWRCDCGLGPFLGWLRQHPGLAGLEEPPRCAGPGKLAGLPLWALPGGDAECPGPRGPPP
HPAADSSSDSSPVHPALAPNSSEPWMWAQPVATGEYQDHGPFWGFYFLLLAVQALITVII
VLAMIKIGQLFRKLIRESSWLSQWENLLII
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgctgaggaggactctgctgtgcgcggtgctcgggcttctgcgcgcccagcccttcccc
tgtccgccggcctgcaagtgtgtcttccgggacgccgcgcagtgctcggggggcgacgtg
gcgcgcatcgccgcgctgggtctgcccaccaacctcacgcacatcctgctcttcggaatg
ggccgcggcgtcttgcagaaccagagcttcagtggcatgaccgtcctgcagcgcctcatg
ctctccgacagccacatttccgccgttgcccccggcgccttcaatgacctggtaaaactg
aaaaccctcaggctgtcgcgcaacaaaatcactcatcttccaggtgcgctgctggataag
acggtgctcctggagcagctgtttttggaccacaatgcgctaaggggcattgaccaaaac
atgtttcagaaactggttaacctgcaggagctcgctctgaaccagaatcagctcgatttc
cttcctgccggtctcttcacgaatctggggaacctgaagttgttggatttatcgggaaac
aacctgacccacctgcccaagggattgcttggagcacaggctaagctcgagaggcttctg
ctccactcgaaccggcttgtgtctctggattcggggctgttgaacagcctgggcgccctg
acggaactgcagctccaccgcaatcacatccgttccatcacacccggggccttcgaccgg
ctcccaaacctgagttctttgactctttcgagaaaccaccttgcgtttctcccctctgcg
ctctttcttcattcgcacagtttgactctgttgactctgttcgagaacccgctggcagag
ctcccgggggtgctcttcggggagatggggggcctgcaggagctgtggctgaaccgcacc
cagctgcgcaccctgcccgttgccgccttccgaaacctgagccgcctgcggtccttaggg
gtgactctgagcccgcggctgagcgcgctcccgcagggcgccttccagggcctgggcgag
ctccgagtgctctccctgcactccaacggcctgaccgccctccccgacggcttgctgcgg
ggcctcggcaggctgcgccaggtgtccctgcgccgcaacaggctgcgcgccctgccccgc
gcgctcttccgcaatctcagcagcctggagagcgtccagctcgaccacaaccagctggag
accctgcctggcgacgcgtttggggctctgccccggctgaaggaggtcctgttggggcac
aacccctggcgctgcgactgtggcctggggcccttcctggggtggctgcggcagcacccg
ggcctcgcgggcctggaagagcccccgcggtgcgcaggccctgggaagctcgccggcctg
ccgctctgggccctgccggggggtgacgcggagtgcccgggcccccggggcccgcctccc
caccccgctgcggacagctcctcggacagctccccggtccatccagccttggctcccaac
agctcagaaccctggatgtgggcccagcccgtggccacgggcgaatatcaagatcatggc
ccgttctgggggttttattttttgcttttagctgttcaggccttgatcaccgtgatcatc
gtgcttgctatgattaaaattggccagctctttcgaaaattaatcagagagagctcttgg
ttaagtcaatgggaaaatcttctaattatttag

DBGET integrated database retrieval system