KEGG   Macaca fascicularis (crab-eating macaque): 102119413
Entry
102119413         CDS       T02918                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin subunit alpha 2b
  KO
K06476  integrin alpha 2B
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04015  Rap1 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05165  Human papillomavirus infection
mcf05200  Pathways in cancer
mcf05222  Small cell lung cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102119413 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    102119413 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102119413 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102119413 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102119413 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102119413 (ITGA2B)
   04611 Platelet activation
    102119413 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    102119413 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102119413 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102119413 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102119413 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102119413 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    102119413 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102119413 (ITGA2B)
   05414 Dilated cardiomyopathy
    102119413 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102119413 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102119413 (ITGA2B)
   04515 Cell adhesion molecules [BR:mcf04515]
    102119413 (ITGA2B)
   04090 CD molecules [BR:mcf04090]
    102119413 (ITGA2B)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102119413 (ITGA2B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102119413 (ITGA2B)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102119413 (ITGA2B)
CD molecules [BR:mcf04090]
 Proteins
  102119413 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 102119413
NCBI-ProteinID: XP_005584488
Position
16
AA seq 1090 aa
MSPGAIALCSAHCSASYLGLQFDKKRLPVEESEGKKEELVHSCLGGCGRRKMARALCPLQ
ALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVG
APRTLGPSQEETGSVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVV
SWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVEN
NFSSDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSS
QSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILGSYFQRLH
RLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGTH
TLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEG
LSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASV
QLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQG
RRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEA
GMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDTA
NEGEGAYEAELAVHLPQGAHYMRARSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQ
IGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPAS
LVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYILDI
QPQGGLQCFPQPPVNPLKVDWGLPTPSPSPVHPAHHKRDRRQIFLPEPEQPSRLQDPVLV
SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYA
VPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
PLEEDDEEGE
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgagtccaggggctatagccctttgctctgcccattgctcagcaagttacttggggttg
cagtttgataagaaaagacttcctgtggaggaatctgaagggaagaaggaggagctggtc
cattcctgcctgggaggttgtggaagaaggaagatggccagagctttgtgtccactgcaa
gccctctggcttctggagtgggtgctgctgctcttgggaccttgtgctgcccctccagcc
tgggccttgaacctggacccagtgcatctcaccttctatgcaggccccaatggcagccac
tttgggttttcactggacttccacaaggacagccatgggagagtggccatcgtggtgggc
gccccacggacgctgggtcccagccaggaggagacgggcagcgtgttcctgtgcccctgg
agggccgagggcggccagtgcccctcgctactctttgacctccgtgatgagacccgaaat
gtaggctcccaaactttacaaaccttcaaggcccgccaaggactaggggcgtcggtcgtc
agctggagcgacgtcattgtggcctgcgccccctggcagcactggaacgtcctagaaaag
accgaggaggctgagaagacgcccgtaggcagctgctttttggctcagccagagagcggc
cgccgcgccgagtactccccctgtcgcgggaacactctgagccgcatttacgtggaaaat
aattttagctcggacaagcgttactgtgaagcgggcttcagctccgtggtcactcaggcc
ggggagctggtgcttggggctcctggaggctattatttcttaggtctcctggcccaggct
ccaattgcggatattttctcgagttaccgcccaggcatccttttgtggcacgtgtcctcc
cagagcctctccttcgactccagcaacccagagtacttcgacggctactgggggtactcg
gtggccgtgggcgagttcgacggggatctcaacactacagagtatgtcgtcggtgccccc
acttggagctggacgctgggagcggtggaaattttgggctcctacttccagaggctgcac
cggctacatggagagcagatggcttcgtattttgggcattcagtggctgtcactgacgtc
aacggggatgggaggcatgacctgctggtgggcgctccactgtatatggagagccgggca
gaccgaaaactggccgaagtggggcgtgtgtatttgttcctgcagccgcgaggcacccac
acgctgggtgcccccagcctcctgctgactggcacacagctctatgggcgattcggctct
gccatcgcacccctgggcgacctcgaccaggatggctacaatgacattgcagtggctgcc
ccctacgggggtcccagtggccggggccaagtgctggtgttcctgggtcagagtgagggg
ctgagttcacgtccctcccaggtcctggacagccccttccccacaggctctgcctttggc
ttctcccttcgaggtgctgtagacatcgatgacaacggatacccagacctgattgtggga
gcttacggggccaaccaggtggctgtgtacagagctcagccagtggtgaaggcctctgtc
cagctactggtacaagattcactgaatcctgctgtgaagagctgtgtcctaccccagacc
aagacacccgtgagctgcttcaaaatccagatgtgtgttggagccactgggcacaacatt
cctcagaagctgtccctaaatgccgagctgcagttggaccggcagaagccccgccagggc
cggcgggtgctgctgctgggctctcaacaggcaggcaccaccctgaacctggatctgggc
ggaaagcacagccccatctgccacaccaccatggccttccttcgagatgaggcagaattc
cgggacaagctgagccccattgtgctcagcctcaatgtgtccctgccgcccacggaggct
ggaatggcccctgctgtcgtgctgcatggagacacccatgtgcaggagcagacacgaatc
gtcctggactgcggggaagatgacgtgtgtgtgccccagcttcagctcactgccagcgtg
acaggctccccgctcctagttggggcagataatgtcctggagctgcagatggacacagcc
aacgagggcgagggagcctatgaagcagagctggccgtgcacctgccccagggggcccac
tacatgcgggcccgaagcaacgttgagggctttgagagactcatctgtaaccagaagaaa
gagaatgagaccagggtggtgctgtgtgagctgggcaatcccatgaagaagaacacccag
ataggaattgcgatgttggtgagcgtggggaatctggaagaggctggggagtctgtgtcc
ttccagctgcagatccggagcaagaacagccagaatccaaacagcaagattgtgctgctg
gatgtgccagtccgggcagaggcccaagtggagctgcgagggaactcctttccagcctcc
ctggtggtggctgcagaagaaggtgacagggagcagaacagcttggacagccggggaccc
aaagtggagcacacctatgagctccacaacaatggccctgggactgtgaatggccttcac
ctcagcatccacctcccggggcagtcccagcactctgacctgctctacatcctggatata
cagccccaggggggccttcagtgcttcccacagcctcctgtcaaccccctcaaggtggac
tgggggctgcccacccccagcccctcccccgttcacccggcccaccacaagcgggatcgc
agacagatcttcctgccagagcccgagcagccctcgaggcttcaggatccagttctcgta
agctgcgactcggcgccctgtactgtggtgcagtgtgacctgcaggagatggcgcgcggg
cagcgggccatggtcacggtgctggctttcctgtggctgcccagcctccaccagaggcca
ctggatcagtttgtgctgcagtcacaggcatggttcaacgtgtcctccctcccctatgcc
gtgcccccgctcagcctgccacgaggggaagctcaggtgcggacacagctgcttcgggcc
ttggaggagagggccattccaatctggtgggtgctggtgggtgtgctgggcggcctgctg
ctgctcaccatcctggtcctggccatgtggaaggtcggcttcttcaagcggaaccggcca
cccctggaagaagatgatgaagagggggagtga

DBGET integrated database retrieval system