KEGG   Macaca fascicularis (crab-eating macaque): 102120798
Entry
102120798         CDS       T02918                                 

Gene name
CD2
Definition
(RefSeq) CD2 molecule
  KO
K06449  T-cell surface glycoprotein CD2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102120798 (CD2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102120798 (CD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102120798 (CD2)
   04090 CD molecules [BR:mcf04090]
    102120798 (CD2)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102120798 (CD2)
CD molecules [BR:mcf04090]
 Proteins
  102120798 (CD2)
SSDB
Motif
Pfam: C2-set V-set Ig_2 I-set DUF5711 Receptor_2B4 SARAF Por_Secre_tail
Other DBs
NCBI-GeneID: 102120798
NCBI-ProteinID: NP_001270706
UniProt: Q6SZ61
Position
1
AA seq 351 aa
MSFPCKFVASFLLIFNVSSKGAVSKEIRNALETWGALGQDIDLDIPSFQMSDDIDDIRWE
KTSDKKKIAQFRKEKETFEEKDAYKLFKNGTLKIKHLKIHDQDSYKVSIYDTKGKNVLEK
TFDLKIQERVSEPKISWTCINTTLTCEVMNGTDPELNLYQDGKHVKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESRMETVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELEIRAHRVATEERGRKPHQIPASTPQNPAASQHPPPPPGHRSQAPSHRPLPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPQGAAENSLSPSSN
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagctttccatgtaaatttgtagccagcttccttctaattttcaacgtttcttccaaa
ggtgcagtctccaaagagattaggaatgctttggaaacctggggagcgctgggtcaggac
atcgacttggacattcctagttttcaaatgagtgatgatattgatgatataagatgggaa
aaaacttcagacaagaaaaagattgcacaattcagaaaagagaaggagactttcgaggaa
aaagatgcatataagctatttaaaaacggaactctgaaaattaagcatctgaagatccat
gatcaggatagctacaaggtatcaatatacgatacaaaaggaaaaaatgtgttggaaaaa
acatttgatttgaagattcaagagagggtctcagaaccaaagatctcctggacttgtatc
aacacaaccctgacctgtgaagtaatgaatggaactgaccccgaattaaacctgtatcaa
gatgggaaacatgtaaaactttctcagagggtcatcacacacaagtggaccaccagcctg
agtgcgaaattcaagtgcacagcagggaacaaagtcagcaaggaatccaggatggagact
gtcagctgtccagagaaaggtctggacatctatctcatcatcggcatttgtggaggaggc
agcctcttgatggtctttgtggcactgctcgttttctacatcaccaaaaggaaaaaacag
aggagtcggagaaatgatgaggagctggagataagagcgcacagagtagctactgaagaa
aggggccggaagccccaccaaattccagcatcaacccctcagaatccagcagcttcccaa
catcctcctccaccacctggtcatcgttcccaggcacctagtcatcgtcccctgcctcct
ggacaccgcgttcagcaccagccccagaagaggcctcctgctccgtcgggcacacaagtt
caccagcagaaaggcccgcccctccccagacctcgagttcagccaaaacctccccaaggg
gcagcagaaaactcattgtccccttcctctaattaa

DBGET integrated database retrieval system