KEGG   Macaca fascicularis (crab-eating macaque): 102122485
Entry
102122485         CDS       T02918                                 

Gene name
NFKB2
Definition
(RefSeq) nuclear factor kappa B subunit 2
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04380  Osteoclast differentiation
mcf04625  C-type lectin receptor signaling pathway
mcf05134  Legionellosis
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102122485 (NFKB2)
   04064 NF-kappa B signaling pathway
    102122485 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102122485 (NFKB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102122485 (NFKB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102122485 (NFKB2)
   05203 Viral carcinogenesis
    102122485 (NFKB2)
  09162 Cancer: specific types
   05224 Breast cancer
    102122485 (NFKB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102122485 (NFKB2)
   05169 Epstein-Barr virus infection
    102122485 (NFKB2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102122485 (NFKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102122485 (NFKB2)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102122485 (NFKB2)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_3 Ank_5 Ank_4 Death
Other DBs
NCBI-GeneID: 102122485
NCBI-ProteinID: XP_005566349
Position
9
AA seq 900 aa
MESCYNPGLDGIIEYDDFKLNSSIMEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAASVPGRDSGEEA
AEPSAPSRAPQCEPQAPEMLQRAREYNARLFCLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIAYVIHHAQDLGVVNLTNHLHQTPLHLAVITRQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDTEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLINAAQSTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTASPSGSLLRSYELAGGDMAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggagagttgctacaacccaggtctggatggcattattgaatatgatgatttcaaattg
aactcctccattatggaacccaaggagccagccccagagacagctgatggcccctacctg
gtgatcgtggaacagcctaagcagagaggcttccgatttcgatatggctgtgaaggcccc
tcccacggaggactgcccggtgcctccagtgagaagggccgaaagacctatcccactgtc
aagatttgtaactacgagggaccagccaagatcgaggtagacctggtaacacacagtgac
ccacctcgtgctcatgcccacagtctggtgggcaagcaatgctcggagctggggatctgc
gccgtttctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctgcac
gtgactaagaagaacatgatgggaactatgatacaaaaacttcagaggcagcggctccgc
tctaggccccagggccttacggaggccgagcagcgggagctggagcaggaggccaaagaa
ctgaagaaggtgatggatctgagtatagtgcggctgcgcttctctgccttccttagagcc
agtgatggctccttctccctgcccctgaagccagtcatttcccagcccatccatgacagc
aagtctccgggggcatcaaacctgaagatttctcgaatggacaagacagcaggctctgtg
cggggtggtgatgaagtttatctgctttgtgacaaggtgcagaaagatgacattgaggtt
cggttctatgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gtgcataaacagtatgccattgtgttccggacacccccctatcacaagatgaagattgag
cggcccgtaacagtgttcctgcaactgaaacgcaagcgaggaggggatgtgtctgattcc
aaacagttcacctattaccctctggtggaagacaaggaagaggtgcagcggaagcggagg
aaggccttgcccaccttctcccagcccttcgggggtggctcccacatgggtggaggctct
ggaggtgcagcggggggctatggaggagctggaggaggtggcagcctcggtttcttcccc
tcctccctggcctacagcccctaccagtccggcgcgggccccatgggctgctacccggga
ggcgggggcggggcgcagatggccgcctcggtgcccggcagggactccggagaggaagcc
gcggagccgagcgccccctccagggccccccagtgcgagccgcaggccccggagatgctg
cagcgagcccgagagtacaacgcgcgactgttctgcctggcgcagcgcagcgcccgggcc
ctactcgactacggcgtcaccgcggacgcgcgcgcgctgctggcgggacagcgccacctg
ctgacggcgcaggacgagaacggagacacaccgctgcacctggccatcatccatgggcag
accagtgtcattgagcagatagcctatgtcatccaccacgcccaggacctcggcgtcgtc
aacctcaccaaccacctgcaccagacgcccctgcacctggcggtgatcaccaggcagacg
agtgtggtgagctttctgctgcgggtgggtgcagacccagctctgctggatcggcatgga
gactcagccatgcatctggcgctgcgggcaggcgctggtgcccctgagctgctgcgtgca
ctgcttcagagtggagctcctgctgtgccccagctgttgcatatgcctgactttgaggga
ttgtatccagtacacctggcggtccgagcccgaagccctgagtgcctggatctgctggtg
gacagtggggctgaagtggaggccacagaacggcaaggggggcgaacagccttgcatcta
gccaccgagatggaggaactggggttggtcacccatctggtcaccaagctccgggccaac
gtgaatgctcgcacctttgcgggaaacacacccctgcacctggcagctggactggggtac
ccgaccctcacccgcctccttctgaaggctggtgctgacatccatgctgaaaacgaggag
cccctgtgcccgctgccttcaccccctacctctgatagcgactcggacactgaagggcct
gagaaggacacccgaagcagcttccggggccacacgcctcttgacctcacttgcagcacc
aaggtgaagaccttgctgataaatgccgctcagagtaccatggagccacccctgaccccg
cccagccctgcagggccgggactgtcacttggtgatacagctctgcagaacctggagcag
ctgctagacgggccagaagcccagggcagctgggcagagctggcagagcgtctggggctg
cgcagcctggtggacacgtaccgacagacggcctcgcccagcggcagcctcctgcgcagc
tatgagctggctggcggagacatggcaggtctgctggaggccctgtctgatatgggccta
gaggagggagtgaggctgctgaggggtccagagacccgagacaagctgcccagcacagca
gaggtgaaggaagacagtgcatacgggagccagtcagtggagcaggaggcagagaagctg
ggcccaccccctgagccgccaggagggctctgccacgggcacccccagcctcaggtgcac
tga

KEGG   Macaca fascicularis (crab-eating macaque): 102136845
Entry
102136845         CDS       T02918                                 

Gene name
RELB
Definition
(RefSeq) RELB proto-oncogene, NF-kB subunit
  KO
K09253  transcription factor RelB
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04380  Osteoclast differentiation
mcf04625  C-type lectin receptor signaling pathway
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102136845 (RELB)
   04064 NF-kappa B signaling pathway
    102136845 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102136845 (RELB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102136845 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102136845 (RELB)
   05169 Epstein-Barr virus infection
    102136845 (RELB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102136845 (RELB)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102136845 (RELB)
SSDB
Motif
Pfam: RelB_transactiv RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102136845
NCBI-ProteinID: XP_015297361
Position
19
AA seq 440 aa
MRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHS
LVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKN
HQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTG
GEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTV
NVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKK
KPAILDHFLPSHSSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPT
LFTMLDLLPPAPPHASAVVCSAGAVVGEPPGPEPLTLDSYQAPGPGDGGTASLVGSNMFP
NQYREAAFGGGLLSPGPEAT
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcgcttccgctacgagtgcgagggccgctcggccggcagcatccttggggagagcagc
accgaggccagcaagacgctgcccgccatagagctccgggattgcggagggctgcgggag
gtggaggtgactgcctgcctggtgtggaaggactggcctcaccgagtccacccccacagc
ctcgtggggaaagactgcactgacggcgtctgcagagtgcggctccggcctcacgtcagc
ccccggcacagttttaataacctgggcatccagtgtgtgaggaagaaggagattgaggct
gccattgagcggaagattcaactgggcattgacccgtacaatgctgggtccctgaagaac
catcaggaagtagacatgaatgtcgtgaggatctgcttccaggcctcatatcgggaccag
cagggacagatgcgccgcatggaccctgtgctttccgagcccgtctacgataagaaatcc
acaaacacgtcagagctgcggatttgccgaattaacaaggaaagcgggccgtgcacgggt
ggcgaggagctctacttgctatgcgacaaggtgcagaaagaggacatatcagtggtgttc
agcagggcctcctgggaaggtcgggctgacttctcccaggcggacgtgcaccgccagatt
gccattgtgttcaagacgccgccctacgaggacctggagattgtagagcctgtgacagtc
aacgtcttcctgcagcggctcaccgatggggtctgcagcgagccattgcctttcacgtac
ctgcctcgcgaccatgacagctacggcgtggacaagaagcggaaacgggggatgcccgac
gtccttggggagctgaacagctctgacccccatggcatcgagagcaaacggcggaagaaa
aagccagccatcctggaccacttcctgcccagccacagctcaggcccgttcctcccgccg
tcagccctgctgccagaccctgacttcttctctggcaccgtgtccctgcccggcctggag
ccccctggcgggcctgacctcctggatgatggctttgcctacgaccctacggcccccaca
ctcttcaccatgctggacctgctgcccccggcaccaccacatgctagcgctgttgtgtgc
agtgccggagccgtggttggggagccccctggccctgaaccgctgacgctggactcgtac
caggccccgggccccggggatggagggaccgccagcctcgtgggcagcaacatgttcccc
aatcagtaccgcgaggcggcctttgggggcggcctcctatcccccgggcctgaagccacg
tag

DBGET integrated database retrieval system