KEGG   Macaca fascicularis (crab-eating macaque): 102123087
Entry
102123087         CDS       T02918                                 

Gene name
CSF3
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04657  IL-17 signaling pathway
mcf05144  Malaria
mcf05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102123087 (CSF3)
   04151 PI3K-Akt signaling pathway
    102123087 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102123087 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102123087 (CSF3)
   04657 IL-17 signaling pathway
    102123087 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102123087 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    102123087 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102123087 (CSF3)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  CSF and other factors
   102123087 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 Img2 NAGLU
Other DBs
NCBI-GeneID: 102123087
NCBI-ProteinID: XP_015293940
UniProt: A0A2K5TUV9
Position
16
AA seq 200 aa
MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEK
LCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEG
ISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVA
SHLQRFLELAYRVLRHLAQS
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtctcctgagcctgctctgtccccagccctgcagctgctgctgtggcacagcgcactc
tggacagtgcaggaagccacccccctgggccctgccagctccctgccccagagcttcctg
ctcaagtgcttagagcaagtaaggaagatccagggcgacggtgccgcgctgcaggagaag
ctgtgtgccacctacaagctgtgccaccctgaggagctggtgctgcttagacactctctg
ggcatcccctgggctcccctgagcagctgccccagccaggccctgcagctgacaggctgc
ttgagccaactccatagcagcctcttcctctaccagggcctcctgcaggccctggaaggg
atctcccctgagttgagccccaccttggatacactgcagctggacattgccgactttgcc
accaccatctggcagcagatggaagacctgggaatggcccctgccctgcagcccacccag
ggtgccatgccagccttcacctctgccttccagcgccgggcgggaggcgtcctggttgcc
tcccatctgcagcgcttcctggagctagcgtaccgcgttctacgccaccttgcccagtcc
tga

DBGET integrated database retrieval system