KEGG   Macaca fascicularis (crab-eating macaque): 102123605
Entry
102123605         CDS       T02918                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04144  Endocytosis
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102123605 (IL2RA)
   04151 PI3K-Akt signaling pathway
    102123605 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102123605 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102123605 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102123605 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102123605 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    102123605 (IL2RA)
   04659 Th17 cell differentiation
    102123605 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102123605 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102123605 (IL2RA)
   05162 Measles
    102123605 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102123605 (IL2RA)
   04090 CD molecules [BR:mcf04090]
    102123605 (IL2RA)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL2 receptor family
   102123605 (IL2RA)
CD molecules [BR:mcf04090]
 Proteins
  102123605 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102123605
NCBI-ProteinID: NP_001270633
UniProt: H6WS54
Position
9
AA seq 272 aa
MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGETEPSQFPGEEEPQASPDGLPESETSRLVTTTDFRIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKNRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatccatacctgctcatgtggggactgctcacgttcatcacggtgcctggctgccag
gcagagctctgtgacgatgacccgccaaaaatcacacatgccacattcaaagccgtggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcaccctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgctgctcggaacacaacaaaacaagtgacacctcaacctgaagaa
cagaaagaaagaaaaaccacagaaatgcaaagtcaaatgcagctggcggaccaagtgagc
cttccaggtcactgcagggaacctccaccgtgggaaaatgaagccacagaaagaatttat
catttcgtggtggggcagacggtttactaccagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaagatggacccagccc
cagctcatatgcacaggtgaaacggagcccagtcagtttccaggtgaagaggagcctcag
gcaagccccgacggccttcctgagagtgagacttcccgcctcgtcacaacaacagatttt
cgaatacagacagaagtggctgcaaccatggaaacgttcatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctgctgagtgggctcacc
tggcagcggagacagaggaagaatagaagaacaatctag

DBGET integrated database retrieval system