KEGG   Macaca fascicularis (crab-eating macaque): 102124214
Entry
102124214         CDS       T02918                                 

Gene name
CSF1R
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04151  PI3K-Akt signaling pathway
mcf04380  Osteoclast differentiation
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102124214 (CSF1R)
   04014 Ras signaling pathway
    102124214 (CSF1R)
   04015 Rap1 signaling pathway
    102124214 (CSF1R)
   04151 PI3K-Akt signaling pathway
    102124214 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102124214 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102124214 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102124214 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102124214 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102124214 (CSF1R)
   05202 Transcriptional misregulation in cancer
    102124214 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102124214 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102124214 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102124214 (CSF1R)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102124214 (CSF1R)
Protein kinases [BR:mcf01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102124214 (CSF1R)
CD molecules [BR:mcf04090]
 Proteins
  102124214 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig Ig_2 I-set DUF5999 C2-set_2
Other DBs
NCBI-GeneID: 102124214
NCBI-ProteinID: XP_005558297
UniProt: A0A2K5WG90
Position
6
AA seq 976 aa
MGPGVLLLLLVVTAWHGQGIPVIEPSGPELVVKPGETVTLRCVGNGSVEWDGPISPHWTL
YSDGPSSVLTTNNATFQNTRTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAKEVVVFED
QDALLPCLLTDPVLEAGVSLVRLRGRPLLRHTNYSFSPWHGFIIHRAKFIQGQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASNIDVDFDVFLQHN
TTKLAIPQRSDFHDNRYQKVLTLSLGQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LDLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTSINGSGTLLCA
ASGYPQPNVTWLQCAGHTDRCDEAQVLQVWVDPHPEVLSQEPFQKVTVQSLLTAETLEHN
QTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSVMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGADYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSLLQEQAQEDRRERDYTNLPSSSRSGGSGSGSSSSSSEPEEESSSEHLACCEQ
GDIAQPLLQPNNYQFC
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgggcccgggagttctgctgctcctgctggtggtcacagcttggcatggtcagggaatc
ccagtgatagagcccagtggccctgagttggtcgtgaagccgggagaaacggtgaccctg
cgatgtgtgggcaatggcagtgtggaatgggatggccccatatcacctcactggaccctg
tactctgatggccccagcagcgtcctcaccaccaacaacgctaccttccaaaacacaagg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctac
gtcaaagatcctgcccggccctggaacgtgctagcaaaggaggtggtggtgtttgaggac
caggatgcactgctgccctgcctgctcacagacccggtgctggaggcaggcgtctcgctg
gtgcgtctgcgtggtcggcccctcctgcgccacaccaactactccttctcgccctggcac
ggcttcatcatccacagggccaaattcattcagggccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcaacattgacgttgactttgatgtcttcctccaacacaac
accaccaagctcgcaatccctcagcgatctgactttcacgataaccgttaccaaaaagtc
ctgaccctcagcctcggtcaagtcgacttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactctacctccatgttcttccgggtcgtagagagtgcctac
ttggacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcctaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagggctctgacgtttgagctcacccttcgatac
cccccagaggtaagtgtcatatggacctccatcaatggctccggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcgctggccacactgatagg
tgcgatgaggcccaagtgctgcaggtctgggtcgacccacaccctgaggtcctgagccag
gagcccttccagaaggtgaccgtgcagagcctgctgaccgctgagaccttagagcacaac
caaacctatgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccgcacgcatcccccggatgagttcctcttcacaccggtggtggtc
gcctgcatgtccgtcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcattgaccccacgcagctgccttacaatgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggcgcctttgggaaggtggtggaggccaca
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaagaggccctcatgtctgagctgaagatcatgagccacctg
ggccagcatgagaacattgtcaaccttttgggagcctgtactcatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccctggccaggaccccgagggaggcgctgactataag
aacatccacctggagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgagacctgtctctacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctctgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggatgtggca
gcgcgaaatgtgctgttgaccaatgggcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacatcgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccactttccagcagatctgctccctccttcaggagcaagcccaagaggacaggagagag
cgggactataccaatctgccaagcagcagcagaagcggtggtagcggtagcggcagcagc
agcagcagcagtgagccggaggaggagagctctagtgagcacctggcctgctgcgagcaa
ggggatatcgcccagcccttgctgcagcccaacaactatcagttctgctga

DBGET integrated database retrieval system