KEGG   Macaca fascicularis (crab-eating macaque): 102124399
Entry
102124399         CDS       T02918                                 

Gene name
CD7
Definition
(RefSeq) CD7 molecule
  KO
K06457  T-cell surface glycoprotein CD7
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102124399 (CD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102124399 (CD7)
CD molecules [BR:mcf04090]
 Proteins
  102124399 (CD7)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 Herpes_gE
Other DBs
NCBI-GeneID: 102124399
NCBI-ProteinID: XP_005585387
UniProt: A0A2K5VA16
Position
16
AA seq 240 aa
MAGLPRLLLLPLLLALARGLPGALAAQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLR
QLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEI
NVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALP
VALAVVSFLLGLALGVACVLVRTQMKKLCSSRDKNSAACVVYEDMSRSRCNTLSSPNQYQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atggccgggctcccgaggctcctgctgctgcccctcctcctggcgctggctcgtggcctg
cctggggccctggccgcccaagaggtgcagcagtctccccactgcacgattgcccccgtg
ggaggctccgtcaacatcacctgctccaccagcggggaactgcatgggatctacctgagg
cagctcgggccacagccccaaaacatcatttactacgaggacagggtggtgcccactacg
gacaaacggttccagggccgcattgacttctcggggtcccaggacaacctgactattacc
atgcaccacctgcagccgtcggacactggcacctacacctgccaggctgtcacggagatc
aatgtctacggctccggtaccctggtcctggtgacagaggaacagtcccaaggattgcac
agatgctcggacgccccgccgacaggctctgccctccctgtcccgccgacaacctctgcc
ctccctgccctgccaacagcctctgccctccctgccctgccgacagcctctgccctccct
gtggccctggcagtggtctccttcctcctcgggctggccctgggggtggcctgtgtgctg
gtgaggacgcagatgaagaaactgtgctcgtcgcgggataagaattcggcagcgtgtgtg
gtgtacgaggacatgtcccgcagccgctgcaacacgctgtcctcccccaaccagtaccag
tga

DBGET integrated database retrieval system