KEGG   Macaca fascicularis (crab-eating macaque): 102125522
Entry
102125522         CDS       T02918                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05200  Pathways in cancer
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102125522 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102125522 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102125522 (IL5)
   04660 T cell receptor signaling pathway
    102125522 (IL5)
   04658 Th1 and Th2 cell differentiation
    102125522 (IL5)
   04657 IL-17 signaling pathway
    102125522 (IL5)
   04664 Fc epsilon RI signaling pathway
    102125522 (IL5)
   04672 Intestinal immune network for IgA production
    102125522 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102125522 (IL5)
  09163 Immune disease
   05310 Asthma
    102125522 (IL5)
   05320 Autoimmune thyroid disease
    102125522 (IL5)
   05321 Inflammatory bowel disease
    102125522 (IL5)
   05330 Allograft rejection
    102125522 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102125522 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102125522 (IL5)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102125522 (IL5)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Cytokines
   102125522 (IL5)
SSDB
Motif
Pfam: IL5 DUF6034
Other DBs
NCBI-GeneID: 102125522
NCBI-ProteinID: XP_005557787
Position
6
AA seq 132 aa
MLLHLSLLALGAAYMYAIPTEIPTSALVKETLALLSTHRTLLIGNETLRIPVPVHKHHQL
CTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEF
LGVMNTEWIIES
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcttctacatttgagtttgctagctcttggagctgcttacatgtatgccatccccaca
gaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcatcgaact
ctgctgataggcaatgagactctgaggattcctgttcctgtacataaacatcaccaactg
tgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaagggggt
actgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggccaaaaa
aagaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaagagttt
cttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system