KEGG   Macaca fascicularis (crab-eating macaque): 102126394
Entry
102126394         CDS       T02918                                 

Gene name
CD38, ADPRC_1
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00760  Nicotinate and nicotinamide metabolism
mcf01100  Metabolic pathways
mcf04020  Calcium signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04921  Oxytocin signaling pathway
mcf04970  Salivary secretion
mcf04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102126394 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102126394 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102126394 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102126394 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    102126394 (CD38)
   04972 Pancreatic secretion
    102126394 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102126394 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102126394 (CD38)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102126394 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102126394 (CD38)
CD molecules [BR:mcf04090]
 Proteins
  102126394 (CD38)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Hyaluronan
  Cell surface receptors
   102126394 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 102126394
NCBI-ProteinID: NP_001274206
UniProt: Q5VAN0 G7P5B0
Position
5
AA seq 301 aa
MANCEFSPVSGDKPCCRLSRRAQVCLGVCLLVLLILVVVVAVVLPRWRQQWSGSGTTSRF
PETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPC
NKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKD
CSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALE
AWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSG
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccaactgcgagttcagcccggtgtccggggacaaaccctgctgccggctctctagg
agagcccaagtctgtcttggcgtctgtctcctggtcctcctgatcctcgtcgtggtggtc
gcggtggtcctcccgaggtggcgccagcagtggagcgggtcgggcacaaccagccgcttt
cctgagaccgtcctggcacgatgcgtcaagtacactgaagtccatcctgagatgagacat
gtagactgccaaagtgtatgggatgcattcaagggtgcatttatttcaaaatatccttgc
aacattacagaagaagactatcagccactagtgaagttgggaactcagaccgtaccttgc
aacaagactcttctttggagcagaataaaagatctggcccatcagttcacacaggtccag
cgggacatgttcaccctggaggacatgctgctaggctaccttgctgatgacctcacatgg
tgtggagaattcaacactttcgaaataaactatcaatcttgcccagactggagaaaggac
tgcagcaacaaccctgtttcggtattctggaaaacggtttcccgcaggtttgcagaaact
gcctgtggtgtggtccatgtgatgctcaatggatcccgcagtaaaatctttgacaaaaac
agcacttttgggagtgtggaagtccataatttgcaaccagagaaggttcaggcactagag
gcctgggtgatacatggtggaagagaagattccagagacttatgccaggatcccaccata
aaagagctggaatcgattataagcaaaaggaatattagatttttctgcaagaatatctac
agacctgacaagtttcttcagtgtgtgaaaaatcctgaggattcttcttgcctatctggg
atctga

DBGET integrated database retrieval system