KEGG   Macaca fascicularis (crab-eating macaque): 102126397
Entry
102126397         CDS       T02918                                 

Gene name
CD1C
Definition
(RefSeq) CD1c molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04530  Tight junction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102126397 (CD1C)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102126397 (CD1C)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102126397 (CD1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102126397 (CD1C)
CD molecules [BR:mcf04090]
 Proteins
  102126397 (CD1C)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 102126397
NCBI-ProteinID: XP_005595602
UniProt: A0A2K5UXX9
Position
Un
AA seq 332 aa
MLFLQFLLLAVLSGGDNADAAQEHVSFYTIQILSFANQSWAQSQGSGWLDELQTHGWESE
SGRIIFLHTWSKSNFSNEELSDLELLFRVYFFGLTREIQDHASQDYSKYPFEVQVKAGCE
LHSGKSPEGFFRVAFNGLDLLSFQNTTWVPSPDGGSLAPGVCHLLNHQYEGVTETVYNLI
RSTCPRFLLGLLDAGKMYLHRQVRPEAWLSSRRSLGSGRLLLVCHASGFYPKPVWVTWMR
NEQEQLGTKHGDVLPNADGTWYLQVILEVAAEETAGLSCRVRHSSLGGQDIILYWGHHFS
MNWIALIVLVSLVILIVLVLRFKKHCSYQDIL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgctgtttctgcagtttctgttgctagctgttctcagtggtggtgacaatgcagacgca
gcccaggaacacgtctcattctatactatccagatcttatcatttgccaaccaatcctgg
gcacaaagtcagggttcaggatggctggatgagttgcagactcatggctgggagagtgaa
tcaggcagaataattttcctgcacacctggtccaagagcaacttcagcaacgaagagttg
tcagacctagagttgttatttcgtgtctacttctttggattaactcgggagattcaagac
catgccagtcaagattactcaaaatatccctttgaagtacaggtgaaagcaggctgtgaa
ctgcattctggaaagagcccagaaggcttctttcgggtagctttcaacggattagattta
ctgagtttccaaaatacaacatgggtgccatctccagatggcgggagtttggctccaggt
gtctgtcatctactcaatcatcagtatgaaggcgtcacagaaacagtgtataatctcata
agaagcacttgcccccgatttctgttgggtctcctggatgcagggaagatgtatctgcac
aggcaagtgaggccagaggcctggctgtccagtcgccgcagccttgggtctggccgtctg
ttgctggtttgtcatgcctccggcttctacccaaagcctgtttgggtgacatggatgcgg
aatgaacaggagcaactgggcactaaacacggtgatgttcttcctaatgctgatgggaca
tggtatcttcaggtgatcttggaggtggcagctgaggagactgctggcctgtcttgtcga
gtgagacacagcagtctaggaggccaggacatcatcctctactggggacaccacttttcc
atgaattggattgccttgatagtgctggtgtccttggtgattctaatagtccttgtgtta
cggtttaagaagcactgctcatatcaagacatcctgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102127773
Entry
102127773         CDS       T02918                                 

Gene name
CD1A
Definition
(RefSeq) CD1a molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04530  Tight junction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102127773 (CD1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102127773 (CD1A)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102127773 (CD1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102127773 (CD1A)
CD molecules [BR:mcf04090]
 Proteins
  102127773 (CD1A)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 DUF3149
Other DBs
NCBI-GeneID: 102127773
NCBI-ProteinID: XP_005595607
Position
Un
AA seq 342 aa
MRPLGRGAFISGFRGELHWGRKNLEAMFGFGEATGLKEPVSFHVIRIASFSNHSWKRNLI
SGYLGDLQTHTSDRNCSTIIFLWPWSRGNFSNEEWKELEMLFHIRCVRFLEGMHRYSREL
QFEYPFEIQWTGGCELHSGKFSGSFYRLAYQGSDFMSFQNNSWLPSPVAGNMAKRLCKVL
NQNQHQNDIIHSLLSDTCPRLILGLLDAGKAHLQRQVKPEAWLSRGLSPGPGRLQLVCHV
SGFYPKPVWVMWMRGEQEQQGTQRGDILPNADGTWYLRATQEVAAGEAADLSCRVKHSSL
EGQDIILYWEHHSSMGLIILAVIVPLLLLIGLALWFRKRCFR
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagaccactcgggaggggagctttcatatctgggttccgaggagagcttcactgggga
aggaagaatttagaagccatgttcggctttggggaagcaacagggctcaaggagcctgtc
tccttccatgtcatccggatcgcatccttttctaaccattcctggaaacgaaatctgatc
tcaggttatctgggtgatttgcagacccacacttcggacagaaattgcagcaccatcatt
ttcctgtggccctggtccaggggaaacttcagcaacgaggagtggaaggaactggaaatg
ttattccatatacgctgcgttcggttccttgagggaatgcatagatactcccgtgaattg
cagttcgagtatccttttgagatacagtggacaggaggctgtgaactgcactctggaaag
ttctcaggaagcttctataggttagcttatcaaggatcagatttcatgagcttccagaac
aattcatggttgccatctccagtggctgggaatatggccaagcgtctctgcaaagtgctc
aatcagaatcagcatcaaaatgacataatacacagtctcctcagtgacacctgcccacgt
ctcatcttgggtcttcttgatgccggaaaggcacatctccagaggcaagtgaagcccgag
gcctggctgtcccgtggcctcagtcctggccctggccgtctacagcttgtgtgccatgtc
tcaggattctacccaaaacctgtgtgggtgatgtggatgcggggtgagcaggagcagcag
ggcactcagcgaggggacatcctgcccaatgctgacgggacatggtatctccgagcaacc
caggaggtggccgctggggaggcagctgacctgtcctgtcgggtgaagcacagcagtcta
gagggccaggacatcatcctctactgggaacatcacagttccatgggcttgatcatcttg
gcggtgatagtgcctttgcttcttctgataggtcttgcgctttggttcaggaaacgctgt
ttccgttaa

KEGG   Macaca fascicularis (crab-eating macaque): 102139678
Entry
102139678         CDS       T02918                                 

Gene name
CD1E
Definition
(RefSeq) CD1e molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04530  Tight junction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102139678 (CD1E)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102139678 (CD1E)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102139678 (CD1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102139678 (CD1E)
CD molecules [BR:mcf04090]
 Proteins
  102139678 (CD1E)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I
Other DBs
NCBI-GeneID: 102139678
NCBI-ProteinID: XP_005541393
UniProt: A0A2K5V733
Position
1
AA seq 387 aa
MLLLFLLFEGLCCPGENTAAPQALQSYRPAAEDPLSFRMLQISSFANHSWAHSEGSGWLG
DLQTHGWDTVTGTIRFLKPWSHGNFSKQELKNLQSLFQLYFNGFVRIVQASAGQFQLEYP
FEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNVCKVLSRYLDIKE
ILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSRGPSPGPGRLQLVCHVSGFYPKPV
WVMWMRGEQEQRGTQRGDILPNADETWYLRATLDVATGEAAGLSCRVKHSSIEGHDLIIH
WGGYSIFLILICLTVIVNLVILVVVHSRLKKQSSNKNALSPRAPSPVFPMGANTQDTNNS
RHHFCLAQVSWIKNRFLKWKTRLNQLS
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgcttctcctgttcctcctcttcgagggactctgctgtcctggggaaaatacagcagct
ccccaggctctacaatcctaccgtccagcagcagaggaccccctgtccttccgcatgctc
caaatttcctcctttgccaaccacagctgggcacacagtgagggctcaggatggctgggt
gaccttcagactcatggctgggacactgtcacgggcaccatccgctttctgaagccctgg
tcccatggaaacttcagcaagcaggagctgaaaaacttacagtcactgttccagttatac
ttcaatggttttgtccggatagtgcaagcttctgctggtcaatttcagcttgaatacccc
ttcgagatccagatattagctggctgtagaatgaatgccccacaaatcttcttaaatatg
gcatatcaaggatcagatttcctgagtttccaaggaatttcctgggagccatctccagga
gcagggatccgggcccagaatgtctgtaaagtgctcagtcgctacctagatattaaggaa
atactgcaaagccttcttggtcacacctgtcctcgatttcttgcggggctcatggaagca
ggggagtcagaactgaaacgaaaagtgaagccagaagcctggctgtcccgtggccccagt
cctggccctggccgtctgcagcttgtgtgccatgtctcaggattctacccaaagcccgtg
tgggtgatgtggatgcggggtgaacaggagcagcggggcactcagcgaggggacatcctg
cctaatgctgacgagacatggtatctccgagcaaccctggatgtggcaactggggaggca
gctggcctgtcctgtcgggtgaaacacagcagtatagagggccatgatctaatcatccat
tggggtggatattccatctttctcatcctgatctgtttaactgtgatagttaacctggtc
atattggttgtagttcactcacggttaaaaaaacagagttcaaataagaacgctctttct
ccccgtgcacccagccctgtgtttcccatgggagccaacacccaggacaccaataattca
agacatcacttctgcttggcacaagtatcgtggatcaaaaacagattcttgaagtggaag
acacgcctaaaccaactctcgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102141080
Entry
102141080         CDS       T02918                                 

Gene name
CD1B
Definition
(RefSeq) CD1b molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04530  Tight junction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102141080 (CD1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102141080 (CD1B)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102141080 (CD1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102141080 (CD1B)
CD molecules [BR:mcf04090]
 Proteins
  102141080 (CD1B)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 DUF3377
Other DBs
NCBI-GeneID: 102141080
NCBI-ProteinID: XP_005541398
UniProt: A0A2K5UV33
Position
1
AA seq 333 aa
MLLLPFQLLAVLFPGGDSERAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAILLKPWSKGNFSDKEFAELEEIFRVYIFGFAQEVQDFAGDFQIQYPFEIQGIAGC
ELHSGGAIVSFLRGALRGLDFLSVKNASCVPSPEGGSKAEKVCALIMQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMQ
DEQEQRGTQLGDILPNANWTWYLRATLDVAAGEAAGLSCRVKHSSLEGQDIVLYWRNPTS
TGSIVLAIMVPSLLLLLCLALWYMRRRSYQNIP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgctgctgctgccatttcaactgttagctgttctctttcccggtggtgacagtgaacga
gccttccaggggccgacctcctttcatgtcatccagacctcatcctttaccaacagtacc
tgggcacaaactcaaggctcaggctggttggatgatttgcagattcacggctgggatagt
gactcaggcactgccatactcctgaagccttggtctaaaggtaactttagtgataaggag
tttgccgagttagaggagatattccgagtctacatctttggattcgctcaagaagtacaa
gactttgccggtgatttccagatacaatacccctttgagatccagggaatagcaggctgt
gagctacattctggaggtgccatagtaagcttcctgaggggagctctaagaggactggat
ttcctaagtgtcaagaatgcttcatgtgtgccttccccagaaggtggcagcaaggcagag
aaggtctgtgcactaatcatgcaatatcaaggtatcatggaaactgtgagaattctcctc
tatgaaacctgcccccgatatctcttgggcgtcctcaatgcaggaaaagcagatctgcaa
agacaagtgaagcccgaggcctggctgtccagtggccccagtcctggacctggccgtctg
cagcttgtgtgccatgtctcaggattctacccaaagcctgtgtgggtgatgtggatgcag
gatgagcaggagcagcggggcactcagctaggggacatcctgcccaatgctaactggaca
tggtatctccgagcaaccctggatgtggcagctggggaggcagctggcctatcctgtcga
gtgaagcacagcagtttagagggccaggacatcgtcctctactggagaaaccccacctcc
actggctcgattgttttggcaataatggtgccttccttgctcctcttgctatgccttgca
ttgtggtatatgaggcgccggtcatatcagaatatcccatga

KEGG   Macaca fascicularis (crab-eating macaque): 102142140
Entry
102142140         CDS       T02918                                 

Gene name
CD1D
Definition
(RefSeq) CD1d molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04530  Tight junction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102142140 (CD1D)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102142140 (CD1D)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102142140 (CD1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102142140 (CD1D)
CD molecules [BR:mcf04090]
 Proteins
  102142140 (CD1D)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 102142140
NCBI-ProteinID: XP_005541399
Position
1
AA seq 338 aa
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSNWTRTDGLAWLGELQTHSWSN
DSDTIRSLKPWSQGTFSDQQWEALQRVFRVYRSSFTRDVKEFAKMLRLAYPMELQVSAGC
EVQPGNASHNFFHVAFQGSDILSFQGTSWEPAQEAPLWVNLAIQVLNQDNWTKETVQWLL
NDTCPQFVSGLLESGKSELEKQVKPKAWLSRGPSPGPGRRQLVCHVSGFYPKPVWVKWMR
GEQEQQGTQRGDILPNADETWYLRATLEVAAGEAAGLSCRVKHSSLEGQDIVLYWAGGSH
TSVGLIALAVLACLLFLLALIVGFTFRFKRQTSYQGIL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggggtgcctgctgtttctgctgctctgggcgctcctccaggcttggggaagcgctgaa
gtcccgcaaaggcttttccccctccgctgcctccaaatctcgtccttcgccaatagcaac
tggacgcgcaccgatggtttggcgtggctgggggagctgcagacgcacagctggagcaac
gactccgacaccatccgctctctgaagccgtggtcccagggcacgttcagcgaccagcag
tgggaggcgctgcagcgtgtatttcgggtttatcgaagcagcttcaccagggacgtgaag
gaattcgccaaaatgctgcgcttagcctatcccatggagctccaggtgtctgctggctgt
gaggtgcaacctggaaacgcctcacataacttcttccatgtagcgtttcaaggaagtgat
atcctgagtttccaaggaacttcttgggagccagcccaagaggccccactttgggtaaac
ttggccatccaagtgctcaaccaggacaactggacgaaggaaacagtgcagtggctcctt
aatgacacctgcccccaatttgtcagtggcctccttgagtcagggaagtcggaactggag
aagcaagtgaagcccaaggcctggctgtcccgtggccccagtcctggccctggccgtcgg
cagcttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgaagtggatgcgg
ggtgagcaggagcagcagggcactcagcgaggggacatcctgcccaatgctgacgagaca
tggtatctccgagcaaccctggaggtggccgctggggaggcagctggcctgtcctgtcgg
gtgaagcacagcagtctagagggccaggacatcgtcctctactgggcaggtgggagccac
acctccgtgggcttgatcgccttggcagtcctggcatgcttgctgttcctccttgcactc
attgtaggctttaccttccggtttaagaggcaaacttcctatcagggcatcctgtga

DBGET integrated database retrieval system