KEGG   Macaca fascicularis (crab-eating macaque): 102126446
Entry
102126446         CDS       T02918                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04024  cAMP signaling pathway
mcf04137  Mitophagy - animal
mcf04210  Apoptosis
mcf04310  Wnt signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04530  Tight junction
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04912  GnRH signaling pathway
mcf04915  Estrogen signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04926  Relaxin signaling pathway
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05030  Cocaine addiction
mcf05031  Amphetamine addiction
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05161  Hepatitis B
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05171  Coronavirus disease - COVID-19
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05224  Breast cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05321  Inflammatory bowel disease
mcf05323  Rheumatoid arthritis
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102126446 (JUN)
   04012 ErbB signaling pathway
    102126446 (JUN)
   04310 Wnt signaling pathway
    102126446 (JUN)
   04668 TNF signaling pathway
    102126446 (JUN)
   04024 cAMP signaling pathway
    102126446 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102126446 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102126446 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102126446 (JUN)
   04530 Tight junction
    102126446 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102126446 (JUN)
   04621 NOD-like receptor signaling pathway
    102126446 (JUN)
   04625 C-type lectin receptor signaling pathway
    102126446 (JUN)
   04660 T cell receptor signaling pathway
    102126446 (JUN)
   04658 Th1 and Th2 cell differentiation
    102126446 (JUN)
   04659 Th17 cell differentiation
    102126446 (JUN)
   04657 IL-17 signaling pathway
    102126446 (JUN)
   04662 B cell receptor signaling pathway
    102126446 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102126446 (JUN)
   04915 Estrogen signaling pathway
    102126446 (JUN)
   04921 Oxytocin signaling pathway
    102126446 (JUN)
   04926 Relaxin signaling pathway
    102126446 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102126446 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102126446 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102126446 (JUN)
   05203 Viral carcinogenesis
    102126446 (JUN)
   05231 Choline metabolism in cancer
    102126446 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102126446 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102126446 (JUN)
   05211 Renal cell carcinoma
    102126446 (JUN)
   05224 Breast cancer
    102126446 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102126446 (JUN)
   05170 Human immunodeficiency virus 1 infection
    102126446 (JUN)
   05161 Hepatitis B
    102126446 (JUN)
   05171 Coronavirus disease - COVID-19
    102126446 (JUN)
   05162 Measles
    102126446 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102126446 (JUN)
   05169 Epstein-Barr virus infection
    102126446 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102126446 (JUN)
   05135 Yersinia infection
    102126446 (JUN)
   05133 Pertussis
    102126446 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102126446 (JUN)
   05142 Chagas disease
    102126446 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102126446 (JUN)
   05321 Inflammatory bowel disease
    102126446 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    102126446 (JUN)
   05031 Amphetamine addiction
    102126446 (JUN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102126446 (JUN)
   05418 Fluid shear stress and atherosclerosis
    102126446 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102126446 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102126446 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102126446 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102126446 (JUN)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102126446 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch NBP1 TFIIA DUF3450
Other DBs
NCBI-GeneID: 102126446
NCBI-ProteinID: XP_005543289
Position
1
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQPPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgatgatgccctcaacgcctcgttcctcccg
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg
ggcatggtagctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc
gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagccgccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc
gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg
aagcgtatgaggaaccgcattgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system