KEGG   Macaca fascicularis (crab-eating macaque): 102127966
Entry
102127966         CDS       T02918                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04110  Cell cycle
mcf04151  PI3K-Akt signaling pathway
mcf04218  Cellular senescence
mcf04310  Wnt signaling pathway
mcf04350  TGF-beta signaling pathway
mcf04390  Hippo signaling pathway
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04630  JAK-STAT signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf05132  Salmonella infection
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05210  Colorectal cancer
mcf05213  Endometrial cancer
mcf05216  Thyroid cancer
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102127966 (MYC)
   04012 ErbB signaling pathway
    102127966 (MYC)
   04310 Wnt signaling pathway
    102127966 (MYC)
   04350 TGF-beta signaling pathway
    102127966 (MYC)
   04390 Hippo signaling pathway
    102127966 (MYC)
   04630 JAK-STAT signaling pathway
    102127966 (MYC)
   04151 PI3K-Akt signaling pathway
    102127966 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102127966 (MYC)
   04218 Cellular senescence
    102127966 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102127966 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102127966 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102127966 (MYC)
   05202 Transcriptional misregulation in cancer
    102127966 (MYC)
   05206 MicroRNAs in cancer
    102127966 (MYC)
   05205 Proteoglycans in cancer
    102127966 (MYC)
   05230 Central carbon metabolism in cancer
    102127966 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102127966 (MYC)
   05225 Hepatocellular carcinoma
    102127966 (MYC)
   05226 Gastric cancer
    102127966 (MYC)
   05216 Thyroid cancer
    102127966 (MYC)
   05221 Acute myeloid leukemia
    102127966 (MYC)
   05220 Chronic myeloid leukemia
    102127966 (MYC)
   05219 Bladder cancer
    102127966 (MYC)
   05213 Endometrial cancer
    102127966 (MYC)
   05224 Breast cancer
    102127966 (MYC)
   05222 Small cell lung cancer
    102127966 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102127966 (MYC)
   05161 Hepatitis B
    102127966 (MYC)
   05160 Hepatitis C
    102127966 (MYC)
   05163 Human cytomegalovirus infection
    102127966 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102127966 (MYC)
   05169 Epstein-Barr virus infection
    102127966 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102127966 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102127966 (MYC)
   03019 Messenger RNA biogenesis [BR:mcf03019]
    102127966 (MYC)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102127966 (MYC)
Messenger RNA biogenesis [BR:mcf03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102127966 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 102127966
NCBI-ProteinID: XP_005564119
UniProt: G7PCT8
Position
8
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEEEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcaacagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcctttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctagcctcttaccaggctgcgcgcaaagacagcggc
agcccgaaccctgcccgcggccacagcgtctgctccacctccagcttgtacctgcaggat
ctgagcgccgccgcctcggagtgcatcgacccctcagtggtctttccctaccctctcaac
gacagcagctcgcccaagtcctgcgcctcaccggactccagcgccttctcaccgtcctcg
gattctctgctctcctcgacggagtcctccccgcaggccagcccagagcccctggtactc
catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagaggaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggcccctggcaaaaggtcagagtcggga
tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaactacgcggcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccaagcagaggagcaaaagctcatttctgaaaaggatttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system