KEGG   Macaca fascicularis (crab-eating macaque): 102128093
Entry
102128093         CDS       T02918                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04110  Cell cycle
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05206  MicroRNAs in cancer
mcf05212  Pancreatic cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102128093 (E2F2)
   04218 Cellular senescence
    102128093 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102128093 (E2F2)
   05206 MicroRNAs in cancer
    102128093 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102128093 (E2F2)
   05225 Hepatocellular carcinoma
    102128093 (E2F2)
   05226 Gastric cancer
    102128093 (E2F2)
   05214 Glioma
    102128093 (E2F2)
   05220 Chronic myeloid leukemia
    102128093 (E2F2)
   05218 Melanoma
    102128093 (E2F2)
   05219 Bladder cancer
    102128093 (E2F2)
   05215 Prostate cancer
    102128093 (E2F2)
   05224 Breast cancer
    102128093 (E2F2)
   05222 Small cell lung cancer
    102128093 (E2F2)
   05223 Non-small cell lung cancer
    102128093 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102128093 (E2F2)
   05161 Hepatitis B
    102128093 (E2F2)
   05160 Hepatitis C
    102128093 (E2F2)
   05163 Human cytomegalovirus infection
    102128093 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102128093 (E2F2)
   05169 Epstein-Barr virus infection
    102128093 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102128093 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102128093 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102128093 (E2F2)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102128093 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102128093
NCBI-ProteinID: XP_005544525
UniProt: A0A2K5V0F8
Position
1
AA seq 437 aa
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTTYYTPLYPQTAPPAVASG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNIEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
LPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagccaccaaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgtccggc
acctgcctcgatgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctaccggccaaaaggaagctggatctggaggggattgggaggcctgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacctcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatc
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcaaacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ctgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccgtccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

KEGG   Macaca fascicularis (crab-eating macaque): 102138138
Entry
102138138         CDS       T02918                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04110  Cell cycle
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05206  MicroRNAs in cancer
mcf05212  Pancreatic cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102138138 (E2F3)
   04218 Cellular senescence
    102138138 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102138138 (E2F3)
   05206 MicroRNAs in cancer
    102138138 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102138138 (E2F3)
   05225 Hepatocellular carcinoma
    102138138 (E2F3)
   05226 Gastric cancer
    102138138 (E2F3)
   05214 Glioma
    102138138 (E2F3)
   05220 Chronic myeloid leukemia
    102138138 (E2F3)
   05218 Melanoma
    102138138 (E2F3)
   05219 Bladder cancer
    102138138 (E2F3)
   05215 Prostate cancer
    102138138 (E2F3)
   05224 Breast cancer
    102138138 (E2F3)
   05222 Small cell lung cancer
    102138138 (E2F3)
   05223 Non-small cell lung cancer
    102138138 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138138 (E2F3)
   05161 Hepatitis B
    102138138 (E2F3)
   05160 Hepatitis C
    102138138 (E2F3)
   05163 Human cytomegalovirus infection
    102138138 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138138 (E2F3)
   05169 Epstein-Barr virus infection
    102138138 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102138138 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102138138 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102138138 (E2F3)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102138138 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB
Other DBs
NCBI-GeneID: 102138138
NCBI-ProteinID: XP_015305343
Position
4
AA seq 224 aa
MGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTY
QDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPM
KTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEGP
FVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaa
gaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcacc
ctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatat
caagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccct
ccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggcaagt
acccaagggcccattgaggtttatttatgtccagaagagactgaaacacacagtccaatg
aaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttggct
tcaaccaactcaggacatagcgattgctcaatttctatgggaaacctttctcctctggcc
tccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaaggaccg
tttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggaggag
gaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccactggtggaagac
ttcatgtgtagttga

KEGG   Macaca fascicularis (crab-eating macaque): 102146018
Entry
102146018         CDS       T02918                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04110  Cell cycle
mcf04137  Mitophagy - animal
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05206  MicroRNAs in cancer
mcf05212  Pancreatic cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102146018 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102146018 (E2F1)
   04218 Cellular senescence
    102146018 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102146018 (E2F1)
   05206 MicroRNAs in cancer
    102146018 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102146018 (E2F1)
   05225 Hepatocellular carcinoma
    102146018 (E2F1)
   05226 Gastric cancer
    102146018 (E2F1)
   05214 Glioma
    102146018 (E2F1)
   05220 Chronic myeloid leukemia
    102146018 (E2F1)
   05218 Melanoma
    102146018 (E2F1)
   05219 Bladder cancer
    102146018 (E2F1)
   05215 Prostate cancer
    102146018 (E2F1)
   05224 Breast cancer
    102146018 (E2F1)
   05222 Small cell lung cancer
    102146018 (E2F1)
   05223 Non-small cell lung cancer
    102146018 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102146018 (E2F1)
   05161 Hepatitis B
    102146018 (E2F1)
   05160 Hepatitis C
    102146018 (E2F1)
   05163 Human cytomegalovirus infection
    102146018 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102146018 (E2F1)
   05169 Epstein-Barr virus infection
    102146018 (E2F1)
   05165 Human papillomavirus infection
    102146018 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102146018 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102146018 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102146018 (E2F1)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102146018 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102146018
NCBI-ProteinID: XP_005568803
UniProt: A0A2K5W061
Position
10
AA seq 437 aa
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVSGRLEGLTEDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgccagccgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggcggagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatttgaccaccaagcgcttcctg
gagctgctgagccactcggccgacggtgtcgtcgacctgaactgggctgctgaggtgctg
aaagtgcagaaacggcgcatctatgacatcaccaacgtcctcgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggtagccacaccacagtgggcgtcagc
gggcggcttgaggggttgaccgaggacctccggcagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggatactgacagc
cagcgcctggcctatgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcccgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagaccgtgggtgggatcagccctgggaagaccccgtcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctcccccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

DBGET integrated database retrieval system