KEGG   Macaca fascicularis (crab-eating macaque): 102128315
Entry
102128315         CDS       T02918                                 

Gene name
GYPA
Definition
(RefSeq) glycophorin A (MNS blood group)
  KO
K06575  glycophorin A
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
mcf05144  Malaria
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102128315 (GYPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    102128315 (GYPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102128315 (GYPA)
CD molecules [BR:mcf04090]
 Proteins
  102128315 (GYPA)
SSDB
Motif
Pfam: Glycophorin_A AJAP1_PANP_C Claudin_2 Syndecan DUF6040
Other DBs
NCBI-GeneID: 102128315
NCBI-ProteinID: XP_005556050
UniProt: A0A2K5WD82
Position
5
AA seq 162 aa
MYGKIIFVLLLSEIVRISASSTTVPATHTSTSSLDPESYVSSQSNDKHTSDTHPTTPSAH
EVSEFSGRTHYPPEEDNRERVQLVHEFSELVIALIIFGVMAGVIGTILFISYCIRRLRKK
SQSDVQPLPPPDAEVPLSSVEIENPEETDQSNLFTKPNEERT
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtatggaaaaataatctttgtattactattgtcagaaattgtgagaatatcagcatca
agtaccactgttccggcaacgcacacttccacctcttctttggacccagagagttatgtc
tcatcacagtcaaatgataagcacacatcggacacacatccaaccactcctagtgctcat
gaagtttcagaattttctggtagaacccattaccctccagaagaggacaacagagaacgg
gtacaacttgtccatgaattctctgaactagtgatagcactcattatttttggggtgatg
gctggtgtcattggaacgatcctctttatttcttactgtattcgccgactgagaaagaaa
agccaatctgatgtacaacctctccccccacctgacgcagaggtgcctttaagctctgtt
gaaatagaaaatccagaggaaactgatcaatcaaatctgttcaccaaaccaaatgaggaa
agaacataa

DBGET integrated database retrieval system