KEGG   Macaca fascicularis (crab-eating macaque): 102129342
Entry
102129342         CDS       T02918                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04145  Phagosome
mcf04620  Toll-like receptor signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102129342 (CD14)
   04064 NF-kappa B signaling pathway
    102129342 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102129342 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102129342 (CD14)
   04620 Toll-like receptor signaling pathway
    102129342 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102129342 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102129342 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102129342 (CD14)
   05133 Pertussis
    102129342 (CD14)
   05134 Legionellosis
    102129342 (CD14)
   05152 Tuberculosis
    102129342 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102129342 (CD14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102129342 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102129342 (CD14)
   04090 CD molecules [BR:mcf04090]
    102129342 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102129342 (CD14)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102129342 (CD14)
CD molecules [BR:mcf04090]
 Proteins
  102129342 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Receptors
  102129342 (CD14)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6
Other DBs
NCBI-GeneID: 102129342
NCBI-ProteinID: XP_005558045
Position
6
AA seq 375 aa
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPHPDWSEAFQCVSAVEVEIR
VGGLSLEPFLTRVDPDADPRQYADTIKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQE
LTLEDLEITGTMPPLPLEATGLALSSLRLHNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRRPRPDELPQVDNLALDGNPFLVPGTALPQEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggagcgcgcatcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcatcccgactggtccgaagccttccagtgtgtttctgcagtcgaggtggagatccgt
gtcggcggtctcagcctagagccgtttctaacgcgcgtcgatcccgacgccgacccgcgg
cagtatgctgacacgatcaaggctctccgcgtgcggcggctcacagtaggagccgcacag
gttcctgctcagctactggtaggcgccttgcgtgtactagcgtactcccgcctccaggaa
ctgacgctcgaggacctagagataaccggcaccatgcctcccctgcctctggaagccaca
gggcttgcactctccagcttgcgcctacacaacgtgtcgtgggcgacagggcgttcctgg
ctcgccgagctgcagcagtggctcaagcccggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgctttcccggccctcaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatcgcggctctctgtccccacaag
ttcccggccctccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgctgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgcaaaccctagcgctccgagatgtatgtggtccagcgccctaaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccggccaagctcaga
gtgctcgatctcagctgcaacagactgaacaggaggccgcggcctgacgagctgccccag
gtggataacctggcactggacggaaatcccttcctggtccctggaactgccctcccccaa
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

DBGET integrated database retrieval system