KEGG   Macaca fascicularis (crab-eating macaque): 102130968
Entry
102130968         CDS       T02918                                 

Gene name
CD22
Definition
(RefSeq) CD22 molecule
  KO
K06467  CD22 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04640  Hematopoietic cell lineage
mcf04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102130968 (CD22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102130968 (CD22)
   04662 B cell receptor signaling pathway
    102130968 (CD22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102130968 (CD22)
   04091 Lectins [BR:mcf04091]
    102130968 (CD22)
CD molecules [BR:mcf04090]
 Proteins
  102130968 (CD22)
Lectins [BR:mcf04091]
 I-type lectins (Siglecs)
  102130968 (CD22)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set Ig_4 C2-set_2 Ig_5 C1-set Ig_6 Izumo-Ig ICAM_N
Other DBs
NCBI-GeneID: 102130968
NCBI-ProteinID: XP_005588898
UniProt: A0A2K5WCZ6
Position
19
AA seq 848 aa
MHLLGPWLLLLVLEYLAFSDSSKWNIEHPGTIYAWEGACVWVPCTYRVLDGALETFILFH
NPEYNQNMSKFEGTRLYESTKDGKVPSGQKRVQFLGNKINNNCTLSIHPVHVNDSGQLGL
RMVSKTEKWMERIHLNVSERPFPPRIQLPPKLQESQEVTLTCLLNFSCYGYQIQLQWLLE
GAPMRQAAVTLTSLSTKSVFTRSELKFSPQWSHHGKIVTCELHDVDGKVLSEDMVQLNVK
HTPKLTIEVTPNETIVRKGDSVTMTCKVNSSNPEYTTVSWLKDGILLKEQNTLMLTLHKV
TKSQSGRYCCRVSNDVGPATSEKVFLQVQYAPEPSRVQISQSPAVEGSEVNFLCISPANP
LPTNYTWYHNGKEVQGRTEKQFQIQKILPWHAGTYSCEAENILGIGERGPGTELDVQYPP
KKVTMVIENPTPIREGDTVTLSCNYSSSNPIVNHYEWRPRGAWEEPSLGVLKIQNIGWNN
TAVACAACNNWCSWASPVTLNVLYAPRGVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEV
QFFWEKNGSLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVS
MSQGNQVMEGKTATLTCESDANPPVYSYAWFDWNNQSLPYSGRMLRLEPVKVQHSGAYWC
QGTNRVGKGHSPLITLTVYYSPQTIGRRVAVGLGSCLAILILAMCGFKVQRRWKRTQSQQ
GLQENSSGQSFFVRNKKVRRTPLSEGPHSLGCYNPMMEDGISYATLRFPETNTPRTGDAE
TSELQRPPPDCDDTVTYSVLQKRQVGDYENVIPDFPEDEGIHYSELIQFGFGERPQAQEN
VDYVIVKH
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgcatctcctcggcccctggctcctgctcctggttctagaatacttggctttctctgac
tcaagtaaatggaatattgagcaccctggaaccatctacgcctgggagggggcctgtgtc
tgggtcccctgcacctacagagtcctagatggtgccctggaaaccttcatcctgttccac
aatcctgagtataaccagaacatgtcgaagttcgaagggaccagactctatgaaagcaca
aaggatgggaaggttccttcagggcagaaaagggtgcaattcctggggaacaagattaac
aacaactgcacactgagtatccacccagtgcacgtcaatgacagtggtcagctggggctg
aggatggtgtccaagactgagaaatggatggaacgaatacacctcaatgtctccgaaagg
ccttttccacctcgtatccagctccctccaaaacttcaagaatcccaggaagtcactctg
acctgcttgctgaatttctcctgctatgggtatcagatccaattgcagtggttactagag
ggggctccaatgaggcaggctgctgtcaccttgacctccttgagcaccaagtctgtcttc
acccggagcgagctcaagttctcgccacagtggagtcaccatgggaagatcgtgacctgc
gagcttcacgatgtggacgggaaggtcctctccgaagacatggtgcagctgaacgtgaag
cacaccccaaagttgacgatcgaggtcactcccaatgaaaccatagtgaggaagggggac
tctgtgaccatgacctgcaaggtcaacagcagcaacccggagtacacgacggtatcctgg
ctcaaggatggcatcctgctgaaggagcagaatacgctcatgctaaccctgcacaaagtg
accaagtcccagagtgggaggtactgctgtagggtctccaatgacgtgggcccggcaacg
tcggaaaaagtgttcctgcaagtacagtatgccccggaaccttccagggttcagatctcc
cagtcaccggctgtggagggaagtgaagtcaactttctttgcatatcaccagccaatcct
cttccaacaaattacacgtggtaccacaatggcaaagaagtgcagggaaggacagagaag
caattccagatccaaaagatcctcccctggcacgctgggacttattcctgtgaggcggaa
aatattcttggtattggagagaggggcccgggaactgagctggatgtccagtatcctccc
aagaaggtgaccatggtgattgaaaaccccacgccgattcgagaaggagacacggtgacc
ctttcctgtaactacagttccagtaaccccattgttaaccactatgaatggagaccccgt
ggcgcctgggaggagccatcgcttggggtgctgaagatccaaaacattggctggaacaac
acagccgtcgcctgcgcagcttgtaacaactggtgctcgtgggcctcccctgtcaccctg
aatgtcctgtatgccccccgaggcgtgagggtccggaaaatcaagcccctttctgagatt
cactctgggaactcggtcagcctccaatgtgacttctcaagcagccaccccaaagaagtc
cagttcttctgggagaaaaatggcagccttctggggaaagaaagccagctgaattttgac
tccatctccccagaagatgctgggagttacagctgctgggtgaacaactccataggacag
acggcgtccaaggcctggacactcgaagtgctgtatgcacccaggaggctgcgtgtgtcc
atgagccaggggaaccaagtgatggaggggaagacggcaaccctgacctgtgagagtgac
gccaaccctcccgtctacagctacgcctggtttgactggaataaccaaagccttccctac
tccggccggatgctgagattggagccggtgaaggtccagcactccggtgcttactggtgc
caggggaccaacagagtgggcaagggccactcgcctctcatcaccctcaccgtctactat
agcccgcagaccattggcaggcgagtggctgtgggactcgggtcctgcctggccatcctc
atcctggcaatgtgtggattcaaggtccagcgacgttggaagaggacacagagccagcag
gggcttcaggagaattccagtggccagagcttctttgtgaggaacaaaaaggttagaagg
acccccctctctgaaggtccccactccctgggatgctacaatccgatgatggaagatggc
attagctacgccaccctgcgctttcccgagacgaacacaccacgaactggagatgcagag
acctccgagctgcagagacctcccccagactgcgatgacacagtcacttattcagtgttg
cagaagcgtcaggtgggcgactatgagaacgtcattccagattttccagaagatgaggga
attcattactcagagctgattcagtttgggttcggggagcggcctcaggcacaagaaaat
gtggactatgtgatcgtcaagcactga

DBGET integrated database retrieval system