KEGG   Macaca fascicularis (crab-eating macaque): 102132219
Entry
102132219         CDS       T02918                                 

Gene name
CSF3R
Definition
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102132219 (CSF3R)
   04151 PI3K-Akt signaling pathway
    102132219 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102132219 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102132219 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102132219 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102132219 (CSF3R)
   04090 CD molecules [BR:mcf04090]
    102132219 (CSF3R)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  Prolactin receptor family
   102132219 (CSF3R)
CD molecules [BR:mcf04090]
 Proteins
  102132219 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 102132219
NCBI-ProteinID: XP_005544002
UniProt: A0A2K5V2W9
Position
1
AA seq 836 aa
MARLRTCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDLEPQ
ILWRLGAELQPGGRQQRLSDGSQQSTITLPHLNHTRAFLSCCLNWGNSLQILDQVELRAG
YPPAVPRNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSIMDCVPE
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLEPMDVVKLEPPMLRTLDPSPE
AAPPQAGCLQLCWEPWQPALHINQKCELRHKPQSGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSNWSPSLELRTTERAPAVRLNTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFPLPSEAQEVALVAYNSAGTSCPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPRGYVIEWGLSPPSTSNSNKTWRME
QNGSATGFLLQENIRPFQLYEITVTPLYQDAMGPSQHVYAYSQEMAPRHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSTILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNGTVLTLMTLIPEGSELHILLGLFGLLLLLSCLCGTAWLCCSPSRKNPLWP
SVPDPAHSSLGSWVPTIMEEEAFQLPGLGMPPITKLTVLEEDEKKPLPWESHNSSETCGL
PTLVQTYVLQGDLRAASAQPQSQSGTSNQVLYGQLLGSPTSPGPEHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLDFPLLQGIRVHGVEGLESF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgagaacctgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacctggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggagccagcaatctaccatcaccctgccccacctcaaccacactcgggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagctgtaccccgcaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagc
ttcaagagccggggcaactgtcagacccaaggggattccatcatggactgcgtgcccgaa
gacgggcagagccactgctccatcccacgcagacacctgctgttgtaccagaatatgggc
atctgggtgcaggcggagaatgcgctggggaccagcatgtccccacaactgtgccttgag
cccatggacgtcgtgaaactggagccccccatgctgcggaccctggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagttgtgctgggagccatggcagccagccctg
cacataaatcagaagtgtgagctgcgccataagccacagagtggagaagccagctgggca
ctggtgggccccctgccgttggaggcccttcggtatgagctctgtgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcctctgcctggccactggagcaac
tggagtcccagcctggagctgagaactactgaacgggcccccgctgtcagactgaacaca
tggtggcggcagaggcagctggacccccggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacagatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccccctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctcctgtcccacc
ccagtggtcttctcagagagcagaggcccagccctgaccagactccatgccatggcccga
gaccctcacagcctctgggtgggctgggagccccccagtccatggcctcggggctatgtg
attgagtggggcctgagcccccccagcacgagcaatagcaacaagacctggaggatggaa
cagaacgggagcgccacggggtttctgctgcaggagaacatcaggccctttcagctctat
gagatcactgtgactcccttgtaccaggacgccatgggaccctcccagcatgtctatgcc
tactcccaagaaatggccccccgccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaatgctcaaaaccagtcgttctccaccatcctgaatgcc
tcttcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacattcacctc
atggctgccagccaggccggcgccaccaatggtacagtcctcaccctgatgaccttgatc
ccagagggatccgagctacacatcctcctgggcctgttcggcctcctgctcttgctctcc
tgcctctgtggaactgcctggctctgctgcagccccagcaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccactatcatggaagag
gaggccttccagctgcctggcctgggcatgccacccatcaccaagctcacagtgctggag
gaggacgagaagaagccactgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacctaagagcagcttccgcccagccc
caatcccagtccggcaccagcaatcaggtcctctacgggcagctgctgggcagccccaca
agcccagggccagagcactatctccgctgcgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcgacttcccc
ctcctgcaggggatccgagtccatggggtggaggggctggaaagcttctag

DBGET integrated database retrieval system