KEGG   Macaca fascicularis (crab-eating macaque): 102132255
Entry
102132255         CDS       T02918                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04071  Sphingolipid signaling pathway
mcf04115  p53 signaling pathway
mcf04141  Protein processing in endoplasmic reticulum
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04215  Apoptosis - multiple species
mcf04217  Necroptosis
mcf04722  Neurotrophin signaling pathway
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05012  Parkinson disease
mcf05014  Amyotrophic lateral sclerosis
mcf05016  Huntington disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05132  Salmonella infection
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05210  Colorectal cancer
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05216  Thyroid cancer
mcf05217  Basal cell carcinoma
mcf05218  Melanoma
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102132255 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102132255 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102132255 (BAX)
   04215 Apoptosis - multiple species
    102132255 (BAX)
   04217 Necroptosis
    102132255 (BAX)
   04115 p53 signaling pathway
    102132255 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102132255 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    102132255 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102132255 (BAX)
   05202 Transcriptional misregulation in cancer
    102132255 (BAX)
   05203 Viral carcinogenesis
    102132255 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102132255 (BAX)
   05212 Pancreatic cancer
    102132255 (BAX)
   05225 Hepatocellular carcinoma
    102132255 (BAX)
   05226 Gastric cancer
    102132255 (BAX)
   05214 Glioma
    102132255 (BAX)
   05216 Thyroid cancer
    102132255 (BAX)
   05220 Chronic myeloid leukemia
    102132255 (BAX)
   05217 Basal cell carcinoma
    102132255 (BAX)
   05218 Melanoma
    102132255 (BAX)
   05213 Endometrial cancer
    102132255 (BAX)
   05224 Breast cancer
    102132255 (BAX)
   05222 Small cell lung cancer
    102132255 (BAX)
   05223 Non-small cell lung cancer
    102132255 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102132255 (BAX)
   05170 Human immunodeficiency virus 1 infection
    102132255 (BAX)
   05161 Hepatitis B
    102132255 (BAX)
   05160 Hepatitis C
    102132255 (BAX)
   05164 Influenza A
    102132255 (BAX)
   05162 Measles
    102132255 (BAX)
   05168 Herpes simplex virus 1 infection
    102132255 (BAX)
   05163 Human cytomegalovirus infection
    102132255 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102132255 (BAX)
   05169 Epstein-Barr virus infection
    102132255 (BAX)
   05165 Human papillomavirus infection
    102132255 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102132255 (BAX)
   05152 Tuberculosis
    102132255 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102132255 (BAX)
   05014 Amyotrophic lateral sclerosis
    102132255 (BAX)
   05016 Huntington disease
    102132255 (BAX)
   05020 Prion disease
    102132255 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    102132255 (BAX)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102132255 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102132255 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102132255 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102132255 (BAX)
   01524 Platinum drug resistance
    102132255 (BAX)
   01522 Endocrine resistance
    102132255 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcf03029]
    102132255 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcf02000]
    102132255 (BAX)
Mitochondrial biogenesis [BR:mcf03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102132255 (BAX)
Transporters [BR:mcf02000]
 Other transporters
  Pores ion channels [TC:1]
   102132255 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 102132255
NCBI-ProteinID: XP_005589889
UniProt: G7PY54 A0A2K5V7Y8
Position
19
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gagacacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaggctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgtgttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgaactgatcagaaccatcatgggctggacg
ctggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttggtggctggagta
ctcaccgcctccctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system