KEGG   Macaca fascicularis (crab-eating macaque): 102132662
Entry
102132662         CDS       T02918                                 

Gene name
Mafa-DQA, Mafa-DQA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102132662 (Mafa-DQA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102132662 (Mafa-DQA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102132662 (Mafa-DQA)
   04612 Antigen processing and presentation
    102132662 (Mafa-DQA)
   04658 Th1 and Th2 cell differentiation
    102132662 (Mafa-DQA)
   04659 Th17 cell differentiation
    102132662 (Mafa-DQA)
   04672 Intestinal immune network for IgA production
    102132662 (Mafa-DQA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102132662 (Mafa-DQA)
   05164 Influenza A
    102132662 (Mafa-DQA)
   05168 Herpes simplex virus 1 infection
    102132662 (Mafa-DQA)
   05169 Epstein-Barr virus infection
    102132662 (Mafa-DQA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102132662 (Mafa-DQA)
   05152 Tuberculosis
    102132662 (Mafa-DQA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102132662 (Mafa-DQA)
   05140 Leishmaniasis
    102132662 (Mafa-DQA)
  09163 Immune disease
   05310 Asthma
    102132662 (Mafa-DQA)
   05322 Systemic lupus erythematosus
    102132662 (Mafa-DQA)
   05323 Rheumatoid arthritis
    102132662 (Mafa-DQA)
   05320 Autoimmune thyroid disease
    102132662 (Mafa-DQA)
   05321 Inflammatory bowel disease
    102132662 (Mafa-DQA)
   05330 Allograft rejection
    102132662 (Mafa-DQA)
   05332 Graft-versus-host disease
    102132662 (Mafa-DQA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102132662 (Mafa-DQA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102132662 (Mafa-DQA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102132662 (Mafa-DQA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102132662 (Mafa-DQA)
  Exosomal proteins of epithelial cells
   102132662 (Mafa-DQA)
  Exosomal proteins of breast milk
   102132662 (Mafa-DQA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 SKG6
Other DBs
NCBI-GeneID: 102132662
NCBI-ProteinID: NP_001271763
UniProt: F8RBU3
Position
4
AA seq 255 aa
MILNKALMLGALALTTMMSPCGGEDIVADHVASCGVNLYQTYGLSGQFTHEFDGDEQFYV
DLRRKETAWRWPELSKFGGFDPQGALRNLAVLKHNLNIVTKRYNSTAATNEVPEVTVFSK
SPVTLGHPNTLICLVDNIFPPVVNITWLSNGRSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCRVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFII
QGLRSVGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgatgctgggggccctcgccctgaccaccatgatgagcccc
tgtggaggtgaagacatagtcgctgaccatgttgcctcttgcggtgtaaacttgtaccag
acttacggtctctctggccagttcacccatgaatttgatggagatgagcagttctacgtg
gacctgaggaggaaggagacagcctggcgatggcctgagttaagcaaatttggaggtttt
gacccgcagggtgcactgagaaacttggctgtgttaaaacacaacttgaacatcgtgact
aaacgctacaactctaccgctgctaccaatgaggttcccgaggtcacagtgttttccaag
tctcccgtgacactgggtcaccccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtgaacatcacatggttgagcaatgggcgctcagtcacagaaggggtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcagggtggagcactggggcctggacgagcctctt
ctgaaacactgggagccggagattccagcgcccatgtcagagctcacagagactgtggtc
tgcgccctggggttgtctgtgggcctcgtgggcattgtggtgggcactgtcttcatcatt
caaggcctgcgttcagttggtgcttccagacaccaagggcccttgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102133044
Entry
102133044         CDS       T02918                                 

Gene name
DQB1, Mafa-DQB, Mafa-DQB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102133044 (DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102133044 (DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133044 (DQB1)
   04612 Antigen processing and presentation
    102133044 (DQB1)
   04658 Th1 and Th2 cell differentiation
    102133044 (DQB1)
   04659 Th17 cell differentiation
    102133044 (DQB1)
   04672 Intestinal immune network for IgA production
    102133044 (DQB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102133044 (DQB1)
   05164 Influenza A
    102133044 (DQB1)
   05168 Herpes simplex virus 1 infection
    102133044 (DQB1)
   05169 Epstein-Barr virus infection
    102133044 (DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102133044 (DQB1)
   05152 Tuberculosis
    102133044 (DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102133044 (DQB1)
   05140 Leishmaniasis
    102133044 (DQB1)
  09163 Immune disease
   05310 Asthma
    102133044 (DQB1)
   05322 Systemic lupus erythematosus
    102133044 (DQB1)
   05323 Rheumatoid arthritis
    102133044 (DQB1)
   05320 Autoimmune thyroid disease
    102133044 (DQB1)
   05321 Inflammatory bowel disease
    102133044 (DQB1)
   05330 Allograft rejection
    102133044 (DQB1)
   05332 Graft-versus-host disease
    102133044 (DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102133044 (DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102133044 (DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102133044 (DQB1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102133044 (DQB1)
  Exosomal proteins of epithelial cells
   102133044 (DQB1)
  Exosomal proteins of breast milk
   102133044 (DQB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 102133044
NCBI-ProteinID: NP_001306419
UniProt: A0A0E4C374
Position
4
AA seq 261 aa
MPRKKALRIPGGLWGTTVTLMLAMLSTPVAEGRDSPEDFVYQFKGLCYFTNGTERVHYVT
RHIYNREEYVRFDSDWGEYRAVTPLGRPTAEYWNSQKDFLESTRAELDTVCKHNYQLELL
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGIVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQRPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIHHRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcctcggaagaaggctttgcggatccccggaggcctttgggggacaactgtgaccttg
atgctggcgatgctgagcaccccagtggctgagggcagagattctcccgaggatttcgtg
taccagtttaagggcctgtgctacttcaccaacgggacggagcgcgtgcattatgtgacc
agacacatttataaccgagaggagtacgtgcgcttcgacagcgactggggggagtaccgg
gcggtgacgccgctggggcgacctaccgccgagtactggaacagccagaaggacttcctg
gagagcacccgggcggagttggacacggtgtgcaaacacaactaccagttggaactcctc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccgtccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagctggcattgtgtccaccccccttatt
aggaacggtgactggaccttccagatcctggtgatgctagaaatgactccccagcgtgga
gatgtctacacctgccacgtggagcaccccagcctccagagacccatcactgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggtgttggaggttttgtgctg
ggattgatcttcctcgggctgggccttatcatccatcacaggagtcagaaagggctcctg
cactga

KEGG   Macaca fascicularis (crab-eating macaque): 102136468
Entry
102136468         CDS       T02918                                 

Gene name
DPB1, Mafa-DPB, Mafa-DPB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102136468 (DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102136468 (DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136468 (DPB1)
   04612 Antigen processing and presentation
    102136468 (DPB1)
   04658 Th1 and Th2 cell differentiation
    102136468 (DPB1)
   04659 Th17 cell differentiation
    102136468 (DPB1)
   04672 Intestinal immune network for IgA production
    102136468 (DPB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102136468 (DPB1)
   05164 Influenza A
    102136468 (DPB1)
   05168 Herpes simplex virus 1 infection
    102136468 (DPB1)
   05169 Epstein-Barr virus infection
    102136468 (DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102136468 (DPB1)
   05152 Tuberculosis
    102136468 (DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102136468 (DPB1)
   05140 Leishmaniasis
    102136468 (DPB1)
  09163 Immune disease
   05310 Asthma
    102136468 (DPB1)
   05322 Systemic lupus erythematosus
    102136468 (DPB1)
   05323 Rheumatoid arthritis
    102136468 (DPB1)
   05320 Autoimmune thyroid disease
    102136468 (DPB1)
   05321 Inflammatory bowel disease
    102136468 (DPB1)
   05330 Allograft rejection
    102136468 (DPB1)
   05332 Graft-versus-host disease
    102136468 (DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102136468 (DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102136468 (DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102136468 (DPB1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102136468 (DPB1)
  Exosomal proteins of epithelial cells
   102136468 (DPB1)
  Exosomal proteins of breast milk
   102136468 (DPB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig C2-set_2 Marek_A Ig_2
Other DBs
NCBI-GeneID: 102136468
NCBI-ProteinID: XP_015305055
Position
4
AA seq 258 aa
MMVLQVSGTPQTVGLMALLMVLLTSVVQGRATPENYLYQGRQECYAFNGTQRFLERHIYN
REEYARFDSDVGEFRAVTELGRPAVEYWNSQKDFLEEKRAEVDTVCRHNYELDEAVTLQR
RVQPRVNIAPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETTGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHPSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLITC
GVGIFMHRRSKKVQRGSV
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggttctgcaggtttctgggaccccccagacagtgggtctgatggcgttactgatg
gtgctgctcacatctgtggtccagggcagggccactccagagaattacctgtaccaggga
cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagacacatctacaac
cgggaggagtacgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg
gggcggcctgctgtggaatactggaacagccagaaggacttcctggaggagaagcgggca
gaggtggacacggtgtgcagacacaactacgagttggacgaggccgtgaccctgcagcgc
cgagtccagccgagggtgaacatcgccccctccaagaagggtcccttacagcaccacaac
ctgctcgtctgccatgtgacagatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacaactggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacacctgc
caagtggagcaccccagcctggacagtcctgtcactgtggagtggaaggcacagtctgat
tctgcccggagtaagacgctgacgggagccgggggcttcgtgctggggctcatcacctgc
ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgtataa

KEGG   Macaca fascicularis (crab-eating macaque): 102136862
Entry
102136862         CDS       T02918                                 

Gene name
Mafa-DPA, Mafa-DPA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102136862 (Mafa-DPA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102136862 (Mafa-DPA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136862 (Mafa-DPA)
   04612 Antigen processing and presentation
    102136862 (Mafa-DPA)
   04658 Th1 and Th2 cell differentiation
    102136862 (Mafa-DPA)
   04659 Th17 cell differentiation
    102136862 (Mafa-DPA)
   04672 Intestinal immune network for IgA production
    102136862 (Mafa-DPA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102136862 (Mafa-DPA)
   05164 Influenza A
    102136862 (Mafa-DPA)
   05168 Herpes simplex virus 1 infection
    102136862 (Mafa-DPA)
   05169 Epstein-Barr virus infection
    102136862 (Mafa-DPA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102136862 (Mafa-DPA)
   05152 Tuberculosis
    102136862 (Mafa-DPA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102136862 (Mafa-DPA)
   05140 Leishmaniasis
    102136862 (Mafa-DPA)
  09163 Immune disease
   05310 Asthma
    102136862 (Mafa-DPA)
   05322 Systemic lupus erythematosus
    102136862 (Mafa-DPA)
   05323 Rheumatoid arthritis
    102136862 (Mafa-DPA)
   05320 Autoimmune thyroid disease
    102136862 (Mafa-DPA)
   05321 Inflammatory bowel disease
    102136862 (Mafa-DPA)
   05330 Allograft rejection
    102136862 (Mafa-DPA)
   05332 Graft-versus-host disease
    102136862 (Mafa-DPA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102136862 (Mafa-DPA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102136862 (Mafa-DPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102136862 (Mafa-DPA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102136862 (Mafa-DPA)
  Exosomal proteins of epithelial cells
   102136862 (Mafa-DPA)
  Exosomal proteins of breast milk
   102136862 (Mafa-DPA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 102136862
NCBI-ProteinID: NP_001270212
UniProt: S6E293
Position
4
AA seq 260 aa
MRPEDRMFETRAVILRTLSLALLLSLGGAGAIKADHVSTYALFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNITIRRSNYTQAANDPPEV
TMFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGQPVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDYYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGRDPRAQGPL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgtcctgaagacagaatgttcgagaccagagctgttatcttgagaaccctctccttg
gctttgctgctgagtctcggaggagctggggccatcaaggcggaccatgtatcaacttat
gccttgtttgtacagacacatagaccaacaggggagtttatgtttgagtttgatgaagat
gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc
cgagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac
ttgaatatcacgatccggcgttccaactacactcaggccgccaatgatccccctgaggtg
accatgtttcccaaggagcctgtggagctgggccaacccaacaccctcatctgccacatt
gacaagttcttccctccagtgctcaacgtcacgtggctgtgcaacgggcagcccgtcact
gagggtgtcgctgagagcctcttcctgcccagaacagattatagcttccacaagttccat
tacctgacctttgtgccctcagccgaggactactatgactgcagggtggagcactggggc
ttggaccagccgctcctcaaacactgggaggcccaagagccaatccagatgcctgagaca
acggagactgtgctctgtgccctgggcctggtgctgggcctagtgggcatcatcgtgggc
actgtcctcatcataaagtctctgcgatctggccgtgatccccgggcccaggggcccctg
tga

KEGG   Macaca fascicularis (crab-eating macaque): 102137481
Entry
102137481         CDS       T02918                                 

Gene name
Mafa-DOA
Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102137481 (Mafa-DOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102137481 (Mafa-DOA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102137481 (Mafa-DOA)
   04612 Antigen processing and presentation
    102137481 (Mafa-DOA)
   04658 Th1 and Th2 cell differentiation
    102137481 (Mafa-DOA)
   04659 Th17 cell differentiation
    102137481 (Mafa-DOA)
   04672 Intestinal immune network for IgA production
    102137481 (Mafa-DOA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102137481 (Mafa-DOA)
   05164 Influenza A
    102137481 (Mafa-DOA)
   05168 Herpes simplex virus 1 infection
    102137481 (Mafa-DOA)
   05169 Epstein-Barr virus infection
    102137481 (Mafa-DOA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102137481 (Mafa-DOA)
   05152 Tuberculosis
    102137481 (Mafa-DOA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102137481 (Mafa-DOA)
   05140 Leishmaniasis
    102137481 (Mafa-DOA)
  09163 Immune disease
   05310 Asthma
    102137481 (Mafa-DOA)
   05322 Systemic lupus erythematosus
    102137481 (Mafa-DOA)
   05323 Rheumatoid arthritis
    102137481 (Mafa-DOA)
   05320 Autoimmune thyroid disease
    102137481 (Mafa-DOA)
   05321 Inflammatory bowel disease
    102137481 (Mafa-DOA)
   05330 Allograft rejection
    102137481 (Mafa-DOA)
   05332 Graft-versus-host disease
    102137481 (Mafa-DOA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102137481 (Mafa-DOA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102137481 (Mafa-DOA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102137481 (Mafa-DOA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102137481 (Mafa-DOA)
  Exosomal proteins of epithelial cells
   102137481 (Mafa-DOA)
  Exosomal proteins of breast milk
   102137481 (Mafa-DOA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 102137481
NCBI-ProteinID: XP_015305057
Position
4
AA seq 311 aa
MALRAGLILGFHSLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDGEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDVLVERSNRTRAINVPPRVTVFPK
SRVELGQPNILICVVNNIFPPVINITWLRNGQAVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAADVYDCQVEHWGLDAPLLRHWGTEPPPHAPSWPQVSFTLESFPIPPIPSFLSQSSRC
LFHHQMPWRPWSVPWAWPSAWWASSWAPSSSSWAHMCPVPPGNDPSERNDLWETPCRSSW
ICDSSCVLSAL
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctgatcctggggttccacagcctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggtgcctcgggccagttcacccatgaatttgatggggaacagctgttctctgtg
gacctgaagaaaagcgaggctgtgtggcgtctgcctgagtttggcgactttgcccgcttt
gacccacagggtgggctggccggcatcgccgcgatcaaagcccatctggatgtcctggtg
gagcgctccaaccgcaccagagccatcaacgtgcctccacgggtgaccgtgttccccaag
tctcgggtggagctgggccagcccaacatcctcatctgcgtcgtgaacaacatcttcccg
cctgtgatcaatatcacctggctgcgcaatggccaagctgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcggccgcggacgtctatgactgccaggtggagcactggggcctggatgcgccactc
ctcaggcattggggtacggagccccctccccacgcaccctcctggccccaggtttccttt
actctagaatccttccctataccaccaattccttcctttctctcccagagctccaggtgc
ctattccaccaccagatgccatggagaccctggtctgtgccctgggcctggccatcggcc
tggtgggcttcctcgtgggcaccatcctcatcatcatgggcacatatgtgtccagtgccc
ccaggtaacgatccttctgagagaaatgacttgtgggagacaccctgcagatcctcgtgg
atttgtgacagctcttgcgtgctcagtgcgctttaa

KEGG   Macaca fascicularis (crab-eating macaque): 102139994
Entry
102139994         CDS       T02918                                 

Gene name
Mafa-DMA
Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102139994 (Mafa-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102139994 (Mafa-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102139994 (Mafa-DMA)
   04612 Antigen processing and presentation
    102139994 (Mafa-DMA)
   04658 Th1 and Th2 cell differentiation
    102139994 (Mafa-DMA)
   04659 Th17 cell differentiation
    102139994 (Mafa-DMA)
   04672 Intestinal immune network for IgA production
    102139994 (Mafa-DMA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102139994 (Mafa-DMA)
   05164 Influenza A
    102139994 (Mafa-DMA)
   05168 Herpes simplex virus 1 infection
    102139994 (Mafa-DMA)
   05169 Epstein-Barr virus infection
    102139994 (Mafa-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102139994 (Mafa-DMA)
   05152 Tuberculosis
    102139994 (Mafa-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102139994 (Mafa-DMA)
   05140 Leishmaniasis
    102139994 (Mafa-DMA)
  09163 Immune disease
   05310 Asthma
    102139994 (Mafa-DMA)
   05322 Systemic lupus erythematosus
    102139994 (Mafa-DMA)
   05323 Rheumatoid arthritis
    102139994 (Mafa-DMA)
   05320 Autoimmune thyroid disease
    102139994 (Mafa-DMA)
   05321 Inflammatory bowel disease
    102139994 (Mafa-DMA)
   05330 Allograft rejection
    102139994 (Mafa-DMA)
   05332 Graft-versus-host disease
    102139994 (Mafa-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102139994 (Mafa-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102139994 (Mafa-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102139994 (Mafa-DMA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102139994 (Mafa-DMA)
  Exosomal proteins of epithelial cells
   102139994 (Mafa-DMA)
  Exosomal proteins of breast milk
   102139994 (Mafa-DMA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 Ig_2
Other DBs
NCBI-GeneID: 102139994
NCBI-ProteinID: XP_005553412
UniProt: A0A2K5VY81
Position
4
AA seq 261 aa
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPVWRDDLQNHTFLHTVYCQDGSPSMGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKAFCEMMIQQIGPQLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVD
GLSFQAFSYLNITPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtcatgaacagaaccaaggagctgcgctgctacagatgctaccacttctgtggctg
ctaccccactcctgggccgtcccagaagctcctactccagtgtggcgagatgacctgcaa
aaccacacgttcctgcacacagtgtactgccaggatgggagtcccagtatgggactctct
gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct
cgcctgcctgaatttgctgattgggctcaggaacagggagatgctcctgccattttattt
gacaaagcattctgcgagatgatgatccagcaaatagggccacaacttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaggtgttcacgctgaagcccctggagtttggc
aaacccaacacgttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggatctgggcctacttttgtctcagctgtcgat
ggactcagcttccaggccttttcttacttaaacatcacaccggaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccgcag
aacgcactaccctcagatctgctggagaatgtgctgtgtggtgtggcctttggtctgggt
gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt
gactga

KEGG   Macaca fascicularis (crab-eating macaque): 102140649
Entry
102140649         CDS       T02918                                 

Gene name
Mafa-DMB
Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102140649 (Mafa-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102140649 (Mafa-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102140649 (Mafa-DMB)
   04612 Antigen processing and presentation
    102140649 (Mafa-DMB)
   04658 Th1 and Th2 cell differentiation
    102140649 (Mafa-DMB)
   04659 Th17 cell differentiation
    102140649 (Mafa-DMB)
   04672 Intestinal immune network for IgA production
    102140649 (Mafa-DMB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102140649 (Mafa-DMB)
   05164 Influenza A
    102140649 (Mafa-DMB)
   05168 Herpes simplex virus 1 infection
    102140649 (Mafa-DMB)
   05169 Epstein-Barr virus infection
    102140649 (Mafa-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102140649 (Mafa-DMB)
   05152 Tuberculosis
    102140649 (Mafa-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102140649 (Mafa-DMB)
   05140 Leishmaniasis
    102140649 (Mafa-DMB)
  09163 Immune disease
   05310 Asthma
    102140649 (Mafa-DMB)
   05322 Systemic lupus erythematosus
    102140649 (Mafa-DMB)
   05323 Rheumatoid arthritis
    102140649 (Mafa-DMB)
   05320 Autoimmune thyroid disease
    102140649 (Mafa-DMB)
   05321 Inflammatory bowel disease
    102140649 (Mafa-DMB)
   05330 Allograft rejection
    102140649 (Mafa-DMB)
   05332 Graft-versus-host disease
    102140649 (Mafa-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102140649 (Mafa-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102140649 (Mafa-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102140649 (Mafa-DMB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102140649 (Mafa-DMB)
  Exosomal proteins of epithelial cells
   102140649 (Mafa-DMB)
  Exosomal proteins of breast milk
   102140649 (Mafa-DMB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 102140649
NCBI-ProteinID: XP_005553414
UniProt: A0A2K5WDB0
Position
4
AA seq 263 aa
MIIFLPLLLGLSLGCTRAGGFVAHVESTCLLDDDGTAKDFTYCISFNKDLLTCWDPEENK
MVPCEFGVLNPLANGISHYLNQQDTLMQRLRNGLQNCTTHTQPFWGSLTHRTRPPSVQVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGNLVIPHGSGQKTAQPNGDWTYQTLSYL
ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGLISW
RRAGSSSYTPLPGSNYPEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcatattcctgccgctgctgctggggctcagcctgggctgcacaagagcaggtggc
tttgtggcccatgtggaaagcacctgtctactggatgatgatgggactgcaaaggatttc
acatactgtatctccttcaacaaggatctgctgacctgctgggatccagaggagaacaag
atggtcccttgcgaatttggggtgctgaatcccttggccaatggcatctcacattacctc
aaccaacaggacaccctgatgcagcgcttgcgcaatgggcttcagaattgtaccacacac
acccagcccttctggggatcactgacccacaggacacggccaccatctgtgcaagtagcc
caaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagatgtgaccatcacgtggatgaagaacgggaatcttgtcatccctcacggc
agtggccagaagacggcccagcccaatggagactggacgtaccagaccctctcctattta
gccttaaccccctcttacggggacacctacacctgtgtggtggagcacattggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtttgatcagctgg
cggagagctggctcctctagttacactcctcttcctgggtccaattatccagaaggacga
cacatttcctag

KEGG   Macaca fascicularis (crab-eating macaque): 102140782
Entry
102140782         CDS       T02918                                 

Gene name
Mafa-DRB, Mafa-DRB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-16 beta chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102140782 (Mafa-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102140782 (Mafa-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102140782 (Mafa-DRB)
   04612 Antigen processing and presentation
    102140782 (Mafa-DRB)
   04658 Th1 and Th2 cell differentiation
    102140782 (Mafa-DRB)
   04659 Th17 cell differentiation
    102140782 (Mafa-DRB)
   04672 Intestinal immune network for IgA production
    102140782 (Mafa-DRB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102140782 (Mafa-DRB)
   05164 Influenza A
    102140782 (Mafa-DRB)
   05168 Herpes simplex virus 1 infection
    102140782 (Mafa-DRB)
   05169 Epstein-Barr virus infection
    102140782 (Mafa-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102140782 (Mafa-DRB)
   05152 Tuberculosis
    102140782 (Mafa-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102140782 (Mafa-DRB)
   05140 Leishmaniasis
    102140782 (Mafa-DRB)
  09163 Immune disease
   05310 Asthma
    102140782 (Mafa-DRB)
   05322 Systemic lupus erythematosus
    102140782 (Mafa-DRB)
   05323 Rheumatoid arthritis
    102140782 (Mafa-DRB)
   05320 Autoimmune thyroid disease
    102140782 (Mafa-DRB)
   05321 Inflammatory bowel disease
    102140782 (Mafa-DRB)
   05330 Allograft rejection
    102140782 (Mafa-DRB)
   05332 Graft-versus-host disease
    102140782 (Mafa-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102140782 (Mafa-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102140782 (Mafa-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102140782 (Mafa-DRB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102140782 (Mafa-DRB)
  Exosomal proteins of epithelial cells
   102140782 (Mafa-DRB)
  Exosomal proteins of breast milk
   102140782 (Mafa-DRB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 MHC_I C2-set_2 I-set
Other DBs
NCBI-GeneID: 102140782
NCBI-ProteinID: NP_001270848
UniProt: C4PE77
Position
4
AA seq 266 aa
MVCLKLPGGSCMAALTVTLMVLSSPLALAEDTRPRFLWQAKAKCHFFNGTERVRYLERHF
YNQEELVRFDSDVGEYRAVSELGRPVAENWNGQKDYLEQKRAAVDNYCRYNYRVGESFTV
QRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEAYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHAGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgcatggcagctctgacagtgacactgatg
gtgctgagctccccactggctttggctgaggacacccgaccacgtttcttgtggcaggct
aaggctaagtgtcacttcttcaacgggacggagcgggtgcggtacctggagagacacttc
tataaccaggaggagttagtgcgcttcgacagcgacgtgggggagtaccgggcggtgtcg
gagctggggcggcctgtcgccgagaactggaatggccagaaggactacctggagcagaag
cgggccgcggtggacaactactgcagatacaactaccgggttggtgagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaacggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggtcaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggcttac
acctgccaagtggagcacccaagcgtgaccagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggctgggctgttcatctacttcaggaatcagaaaggacacgctggacttcag
ccaacaggactcctgagctga

KEGG   Macaca fascicularis (crab-eating macaque): 102141176
Entry
102141176         CDS       T02918                                 

Gene name
Mafa-DQA, Mafa-DQA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102141176 (Mafa-DQA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102141176 (Mafa-DQA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102141176 (Mafa-DQA)
   04612 Antigen processing and presentation
    102141176 (Mafa-DQA)
   04658 Th1 and Th2 cell differentiation
    102141176 (Mafa-DQA)
   04659 Th17 cell differentiation
    102141176 (Mafa-DQA)
   04672 Intestinal immune network for IgA production
    102141176 (Mafa-DQA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102141176 (Mafa-DQA)
   05164 Influenza A
    102141176 (Mafa-DQA)
   05168 Herpes simplex virus 1 infection
    102141176 (Mafa-DQA)
   05169 Epstein-Barr virus infection
    102141176 (Mafa-DQA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102141176 (Mafa-DQA)
   05152 Tuberculosis
    102141176 (Mafa-DQA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102141176 (Mafa-DQA)
   05140 Leishmaniasis
    102141176 (Mafa-DQA)
  09163 Immune disease
   05310 Asthma
    102141176 (Mafa-DQA)
   05322 Systemic lupus erythematosus
    102141176 (Mafa-DQA)
   05323 Rheumatoid arthritis
    102141176 (Mafa-DQA)
   05320 Autoimmune thyroid disease
    102141176 (Mafa-DQA)
   05321 Inflammatory bowel disease
    102141176 (Mafa-DQA)
   05330 Allograft rejection
    102141176 (Mafa-DQA)
   05332 Graft-versus-host disease
    102141176 (Mafa-DQA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102141176 (Mafa-DQA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102141176 (Mafa-DQA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102141176 (Mafa-DQA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102141176 (Mafa-DQA)
  Exosomal proteins of epithelial cells
   102141176 (Mafa-DQA)
  Exosomal proteins of breast milk
   102141176 (Mafa-DQA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102141176
NCBI-ProteinID: NP_001272272
UniProt: F8RBN3
Position
4
AA seq 255 aa
MILNKALLLGALALTTVMSPCGGEDIVADHVASYGVNMYQSYGPSGQYTHEFDGDEEFYV
DLERKETVWQLPLFSKFRSFDPQGALRNLAVGKHNLNILIKRSNSTVATNEVPEVTVFSK
SPVTLGHPNTLICLVDNIFPPVVNITWLSNGRSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSMGLVGIVVGTVLII
RGLRSVGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgttgctgggggccctcgctctgaccaccgtgatgagcccc
tgtggaggtgaagacatagtggctgaccacgttgcgtcttacggtgtaaacatgtaccag
tcttacggtccctctggccagtacacccatgaatttgatggagacgaggagttctatgtg
gacctggagaggaaggagaccgtctggcagttgcctctgttcagcaaatttagaagtttt
gacccgcagggtgcactgagaaacttggctgtgggaaaacacaacttgaacatcctgatt
aaacgctccaactctaccgttgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacactgggtcaccccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtgaacatcacatggttgagcaatgggcgctcagtcacagaaggggtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt
ctgaaacactgggagccggagattccagcacccatgtcagagctcacagaaactgtggtc
tgcgccctggggttgtctatgggcctcgtgggcattgtggtggggaccgtcttgatcatc
cgaggcctgcgttcagttggtgcctccagacaccaagggcccttgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102141582
Entry
102141582         CDS       T02918                                 

Gene name
Mafa-DRB, Mafa-DRB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102141582 (Mafa-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102141582 (Mafa-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102141582 (Mafa-DRB)
   04612 Antigen processing and presentation
    102141582 (Mafa-DRB)
   04658 Th1 and Th2 cell differentiation
    102141582 (Mafa-DRB)
   04659 Th17 cell differentiation
    102141582 (Mafa-DRB)
   04672 Intestinal immune network for IgA production
    102141582 (Mafa-DRB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102141582 (Mafa-DRB)
   05164 Influenza A
    102141582 (Mafa-DRB)
   05168 Herpes simplex virus 1 infection
    102141582 (Mafa-DRB)
   05169 Epstein-Barr virus infection
    102141582 (Mafa-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102141582 (Mafa-DRB)
   05152 Tuberculosis
    102141582 (Mafa-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102141582 (Mafa-DRB)
   05140 Leishmaniasis
    102141582 (Mafa-DRB)
  09163 Immune disease
   05310 Asthma
    102141582 (Mafa-DRB)
   05322 Systemic lupus erythematosus
    102141582 (Mafa-DRB)
   05323 Rheumatoid arthritis
    102141582 (Mafa-DRB)
   05320 Autoimmune thyroid disease
    102141582 (Mafa-DRB)
   05321 Inflammatory bowel disease
    102141582 (Mafa-DRB)
   05330 Allograft rejection
    102141582 (Mafa-DRB)
   05332 Graft-versus-host disease
    102141582 (Mafa-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102141582 (Mafa-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102141582 (Mafa-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102141582 (Mafa-DRB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102141582 (Mafa-DRB)
  Exosomal proteins of epithelial cells
   102141582 (Mafa-DRB)
  Exosomal proteins of breast milk
   102141582 (Mafa-DRB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 I-set DUF202
Other DBs
NCBI-GeneID: 102141582
NCBI-ProteinID: NP_001271090
UniProt: I7HFJ4
Position
4
AA seq 266 aa
MVCLKLPGGSCMAALTVTLMVLSSPLALTGDIRPRFLEYCKFECHFFNGTELMLYLIRYF
HNQEEYVRYDSDVGEYRAVTELGRPVAENWNSQKDLLEQRRAEVDTYCRHNYGVGESFTV
QRRVQPKVTVYPAKTQPLQHHTLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIHNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFVYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgcatggcagctctgacagtgacactgatg
gtgctgagctccccactggctttgactggggacatccgaccacgtttcttagagtactgt
aagtttgagtgtcatttcttcaatgggacggagctgatgctgtacctgatcagatacttc
cataaccaagaggagtacgtgcgctacgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgtcgccgagaactggaacagccagaaggacctcctggagcagagg
cgggccgaggtggacacctactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaccctcctggtctgctctgtgagtggtttctatcccggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtttac
acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcgtctacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Macaca fascicularis (crab-eating macaque): 102141962
Entry
102141962         CDS       T02918                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-10 beta chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102141962
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102141962
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102141962
   04612 Antigen processing and presentation
    102141962
   04658 Th1 and Th2 cell differentiation
    102141962
   04659 Th17 cell differentiation
    102141962
   04672 Intestinal immune network for IgA production
    102141962
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102141962
   05164 Influenza A
    102141962
   05168 Herpes simplex virus 1 infection
    102141962
   05169 Epstein-Barr virus infection
    102141962
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102141962
   05152 Tuberculosis
    102141962
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102141962
   05140 Leishmaniasis
    102141962
  09163 Immune disease
   05310 Asthma
    102141962
   05322 Systemic lupus erythematosus
    102141962
   05323 Rheumatoid arthritis
    102141962
   05320 Autoimmune thyroid disease
    102141962
   05321 Inflammatory bowel disease
    102141962
   05330 Allograft rejection
    102141962
   05332 Graft-versus-host disease
    102141962
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102141962
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102141962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102141962
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102141962
  Exosomal proteins of epithelial cells
   102141962
  Exosomal proteins of breast milk
   102141962
SSDB
Motif
Pfam: C1-set Ig_3 DUF202
Other DBs
NCBI-GeneID: 102141962
NCBI-ProteinID: XP_015304386
Position
4
AA seq 168 aa
MRFLLPSHKNCIVESLLVSGIFLGISTPIQPKVTVYPAKTEPLQHHSLLVCSVNGFYPGS
IEVRWFQNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGTCQLEHPSVMSPLTVQWR
ARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLRPTGLLS
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaggtttcttcttccttctcacaaaaattgtattgttgagagtctgctagtgtcaggg
attttcctgggcataagcaccccaatccaacctaaggtgactgtgtatcctgcaaagacc
gagcctctgcagcaccacagcctcctggtctgctctgtgaacggtttctatccaggcagc
attgaagtcaggtggttccagaacggccaggaagagaaggctggggtggtgtccacaggc
ctgatccagaatggagactggaccttccagaccctggtgatgctggaaacagttcctcag
agtggaacctgccaactggagcatccaagcgtgatgagccctctcacagtgcaatggaga
gcacggtctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggc
ctgctcttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctgga
cttcggccaacaggactcctgagctga

KEGG   Macaca fascicularis (crab-eating macaque): 102142740
Entry
102142740         CDS       T02918                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR beta 4 chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102142740
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102142740
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102142740
   04612 Antigen processing and presentation
    102142740
   04658 Th1 and Th2 cell differentiation
    102142740
   04659 Th17 cell differentiation
    102142740
   04672 Intestinal immune network for IgA production
    102142740
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102142740
   05164 Influenza A
    102142740
   05168 Herpes simplex virus 1 infection
    102142740
   05169 Epstein-Barr virus infection
    102142740
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102142740
   05152 Tuberculosis
    102142740
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102142740
   05140 Leishmaniasis
    102142740
  09163 Immune disease
   05310 Asthma
    102142740
   05322 Systemic lupus erythematosus
    102142740
   05323 Rheumatoid arthritis
    102142740
   05320 Autoimmune thyroid disease
    102142740
   05321 Inflammatory bowel disease
    102142740
   05330 Allograft rejection
    102142740
   05332 Graft-versus-host disease
    102142740
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102142740
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102142740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102142740
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102142740
  Exosomal proteins of epithelial cells
   102142740
  Exosomal proteins of breast milk
   102142740
SSDB
Motif
Pfam: MHC_II_beta
Other DBs
NCBI-GeneID: 102142740
NCBI-ProteinID: XP_015305062
Position
4
AA seq 143 aa
MIRGSRKCLLGGGSQKEEVQVAVMRQMILVQSLAKRRPAQLGNRERIPNAHFLEQIEHEC
YVSNGTERMRFVQRLIHTRRSMRASTATWESSGRWRSWSGGESRNGNSQKNLLGYLRGLL
DTYCRHNYGVLLTAEARGDRLIG
NT seq 432 nt   +upstreamnt  +downstreamnt
atgataagagggagcaggaagtgtcttttgggtggaggctcccagaaggaggaagtgcaa
gtagcagtgatgaggcagatgatcctggtccagagccttgcaaagaggcgtccagctcaa
ctcggcaatagggaacgaatcccgaatgcacatttcttggagcagattgaacatgagtgc
tatgtctccaacgggacggagcggatgcggtttgtgcagagactcatccatacccggagg
agtatgcgcgcttccacagcgacgtgggaaagttccgggcggtggcggagctggagcgga
ggagagtccaggaatggaaacagccagaagaacctcctgggctacttgcggggtctgttg
gacacctactgcagacacaactatggggttttgctcaccgcagaggcgcgaggagataga
ttgattggctga

KEGG   Macaca fascicularis (crab-eating macaque): 102144039
Entry
102144039         CDS       T02918                                 

Gene name
DRA, Mafa-DRA, Mamu-DRA
Definition
(RefSeq) mamu class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102144039 (DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102144039 (DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102144039 (DRA)
   04612 Antigen processing and presentation
    102144039 (DRA)
   04658 Th1 and Th2 cell differentiation
    102144039 (DRA)
   04659 Th17 cell differentiation
    102144039 (DRA)
   04672 Intestinal immune network for IgA production
    102144039 (DRA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102144039 (DRA)
   05164 Influenza A
    102144039 (DRA)
   05168 Herpes simplex virus 1 infection
    102144039 (DRA)
   05169 Epstein-Barr virus infection
    102144039 (DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102144039 (DRA)
   05152 Tuberculosis
    102144039 (DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102144039 (DRA)
   05140 Leishmaniasis
    102144039 (DRA)
  09163 Immune disease
   05310 Asthma
    102144039 (DRA)
   05322 Systemic lupus erythematosus
    102144039 (DRA)
   05323 Rheumatoid arthritis
    102144039 (DRA)
   05320 Autoimmune thyroid disease
    102144039 (DRA)
   05321 Inflammatory bowel disease
    102144039 (DRA)
   05330 Allograft rejection
    102144039 (DRA)
   05332 Graft-versus-host disease
    102144039 (DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102144039 (DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102144039 (DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102144039 (DRA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102144039 (DRA)
  Exosomal proteins of epithelial cells
   102144039 (DRA)
  Exosomal proteins of breast milk
   102144039 (DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102144039
NCBI-ProteinID: NP_001270278
UniProt: A4L283 G7P2R1
Position
4
AA seq 254 aa
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNNTPITNVPPEVTVLTNS
PVELGEPNVLICFIDKFSPPVVKVTWLKNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDIYDCKVEHWGLDAPLLKHWEFDAPSPLPETTENVVCALGLIVGLVGIIVGTVFIIK
GVRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataagtggagtccccgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacacgtgatcatccaggctgagttctatctgaac
cctgaccaatcaggagagtttatgtttgactttgatggtgatgagattttccacgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaacaatactccaatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgggagagcccaacgtcctcatctgtttcatcgacaagttctctccacca
gtggtcaaagttacatggcttaaaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacatttatgactgcaaggtggagcactggggcttggatgcacctcttctc
aagcactgggagtttgatgcaccaagccctctcccagagactacagagaacgtggtttgt
gccctgggcctgattgtgggtctggtgggcatcatcgttgggaccgtcttcatcatcaag
ggtgtgcgcaaaagcaatgctgcagaacgcagggggcctctgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102144414
Entry
102144414         CDS       T02918                                 

Gene name
Mafa-DRB, Mafa-DRB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-13 beta chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102144414 (Mafa-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102144414 (Mafa-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102144414 (Mafa-DRB)
   04612 Antigen processing and presentation
    102144414 (Mafa-DRB)
   04658 Th1 and Th2 cell differentiation
    102144414 (Mafa-DRB)
   04659 Th17 cell differentiation
    102144414 (Mafa-DRB)
   04672 Intestinal immune network for IgA production
    102144414 (Mafa-DRB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102144414 (Mafa-DRB)
   05164 Influenza A
    102144414 (Mafa-DRB)
   05168 Herpes simplex virus 1 infection
    102144414 (Mafa-DRB)
   05169 Epstein-Barr virus infection
    102144414 (Mafa-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102144414 (Mafa-DRB)
   05152 Tuberculosis
    102144414 (Mafa-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102144414 (Mafa-DRB)
   05140 Leishmaniasis
    102144414 (Mafa-DRB)
  09163 Immune disease
   05310 Asthma
    102144414 (Mafa-DRB)
   05322 Systemic lupus erythematosus
    102144414 (Mafa-DRB)
   05323 Rheumatoid arthritis
    102144414 (Mafa-DRB)
   05320 Autoimmune thyroid disease
    102144414 (Mafa-DRB)
   05321 Inflammatory bowel disease
    102144414 (Mafa-DRB)
   05330 Allograft rejection
    102144414 (Mafa-DRB)
   05332 Graft-versus-host disease
    102144414 (Mafa-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102144414 (Mafa-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102144414 (Mafa-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102144414 (Mafa-DRB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102144414 (Mafa-DRB)
  Exosomal proteins of epithelial cells
   102144414 (Mafa-DRB)
  Exosomal proteins of breast milk
   102144414 (Mafa-DRB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 I-set C2-set_2
Other DBs
NCBI-GeneID: 102144414
NCBI-ProteinID: NP_001271570
UniProt: G2ZG71
Position
4
AA seq 266 aa
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF
YNQEENVRFDSDVGEYRAVSELGRPDAEYWNSQKDILEDQRASVDTFCRHNYRVAESFTV
QRRVQPKVTVYPSKTQPLQHHTLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgcatggcagctctcacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttggagtactct
acatctgagtgtcacttcttcaacgggacggagcgggtgcggtacctggacagatacttc
tataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagtaccgggcggtgtcg
gagctggggcggcctgacgccgagtactggaacagccagaaggacatcctggaagaccag
cgggcctcggtggacaccttctgcagacacaactaccgggttgcggagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cacaccctcctggtctgctctgtgaacggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtttac
acctgccaagtggaacacccaagcgtgaccagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggagccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Macaca fascicularis (crab-eating macaque): 102144782
Entry
102144782         CDS       T02918                                 

Gene name
DQB1, Mafa-DQB, Mafa-DQB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102144782 (DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102144782 (DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102144782 (DQB1)
   04612 Antigen processing and presentation
    102144782 (DQB1)
   04658 Th1 and Th2 cell differentiation
    102144782 (DQB1)
   04659 Th17 cell differentiation
    102144782 (DQB1)
   04672 Intestinal immune network for IgA production
    102144782 (DQB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102144782 (DQB1)
   05164 Influenza A
    102144782 (DQB1)
   05168 Herpes simplex virus 1 infection
    102144782 (DQB1)
   05169 Epstein-Barr virus infection
    102144782 (DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102144782 (DQB1)
   05152 Tuberculosis
    102144782 (DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102144782 (DQB1)
   05140 Leishmaniasis
    102144782 (DQB1)
  09163 Immune disease
   05310 Asthma
    102144782 (DQB1)
   05322 Systemic lupus erythematosus
    102144782 (DQB1)
   05323 Rheumatoid arthritis
    102144782 (DQB1)
   05320 Autoimmune thyroid disease
    102144782 (DQB1)
   05321 Inflammatory bowel disease
    102144782 (DQB1)
   05330 Allograft rejection
    102144782 (DQB1)
   05332 Graft-versus-host disease
    102144782 (DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102144782 (DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102144782 (DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102144782 (DQB1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102144782 (DQB1)
  Exosomal proteins of epithelial cells
   102144782 (DQB1)
  Exosomal proteins of breast milk
   102144782 (DQB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 102144782
NCBI-ProteinID: NP_001270101
UniProt: F8K939
Position
4
AA seq 261 aa
MPRKKALRIPGGLWGTTVTLMLAMLSTPVAGGRDSPEDFVYQFKGLCYFTNGTERVRLVT
RYIYNREEYVRFDSDWGEYRAVTPLGPPAAEYWNSQKDILERTRAELDTVCRHNYQSELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGIVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIHYRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcctcggaagaaggctttgcggattcccggaggcctttgggggacaactgtgaccttg
atgctggcgatgctgagcaccccagtggctgggggcagagactctcccgaggatttcgtg
taccagtttaagggcctgtgctacttcaccaacgggacggagcgcgtgcgtcttgtgacc
agatacatctataaccgagaggagtacgtgcgcttcgacagcgactggggggagtaccgg
gcggtgacgccgctggggccgcctgctgcagagtactggaacagccagaaggacatcctg
gagaggacccgggcggaactggacacggtgtgcagacacaactaccagtcagagctccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagccggcattgtgtccacccccctcatt
aggaacggcgactggaccttccagatcctggtgatgctggaaatgactccccagcgtgga
gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggtgttggaggcttcgtgctg
ggactgatcttccttgggttgggccttatcatccattacaggagtcagaaagggctcctg
cactga

KEGG   Macaca fascicularis (crab-eating macaque): 102145413
Entry
102145413         CDS       T02918                                 

Gene name
Mafa-DOB
Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102145413 (Mafa-DOB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102145413 (Mafa-DOB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102145413 (Mafa-DOB)
   04612 Antigen processing and presentation
    102145413 (Mafa-DOB)
   04658 Th1 and Th2 cell differentiation
    102145413 (Mafa-DOB)
   04659 Th17 cell differentiation
    102145413 (Mafa-DOB)
   04672 Intestinal immune network for IgA production
    102145413 (Mafa-DOB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102145413 (Mafa-DOB)
   05164 Influenza A
    102145413 (Mafa-DOB)
   05168 Herpes simplex virus 1 infection
    102145413 (Mafa-DOB)
   05169 Epstein-Barr virus infection
    102145413 (Mafa-DOB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102145413 (Mafa-DOB)
   05152 Tuberculosis
    102145413 (Mafa-DOB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102145413 (Mafa-DOB)
   05140 Leishmaniasis
    102145413 (Mafa-DOB)
  09163 Immune disease
   05310 Asthma
    102145413 (Mafa-DOB)
   05322 Systemic lupus erythematosus
    102145413 (Mafa-DOB)
   05323 Rheumatoid arthritis
    102145413 (Mafa-DOB)
   05320 Autoimmune thyroid disease
    102145413 (Mafa-DOB)
   05321 Inflammatory bowel disease
    102145413 (Mafa-DOB)
   05330 Allograft rejection
    102145413 (Mafa-DOB)
   05332 Graft-versus-host disease
    102145413 (Mafa-DOB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102145413 (Mafa-DOB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102145413 (Mafa-DOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102145413 (Mafa-DOB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102145413 (Mafa-DOB)
  Exosomal proteins of epithelial cells
   102145413 (Mafa-DOB)
  Exosomal proteins of breast milk
   102145413 (Mafa-DOB)
SSDB
Motif
Pfam: MHC_II_beta C1-set ig C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 102145413
NCBI-ProteinID: XP_005553427
UniProt: A0A2K5WBB5
Position
4
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSREAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTALLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERAGVMSTGLIGNGDWT
FQTVVMLEMTPELGDVYTCLVHHSSLLSPVSVEWRVQSEYSWRKMLSGIAAFLLGLIFLL
MGIIIQLRAQKGYVRTQMSGDEVSRAVLLPQPC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgaccagactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtacgtacgtttcgacagtgatgtggggatgtttgtggcattgacgaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcctggagaggagcagagaggcc
gtggatggggtctgtagacacaactacagactgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccgcactcctgcaccagcataatctg
ctgcactgctctgtgacgggcttctatccaggggacatcaagatcaggtggttcctgaat
gggcaggaggagagagctggggtcatgtccactggccttatcgggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggagatgtctacacctgcctt
gtccatcactccagcctactgagccccgtttctgtggagtggagagttcagtctgaatat
tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
atgggaatcatcatccagcttagggctcagaaaggatatgtgaggacacagatgtctggt
gatgaggtctcaagagctgttctgctccctcagccatgctga

DBGET integrated database retrieval system