KEGG   Macaca fascicularis (crab-eating macaque): 102132744
Entry
102132744         CDS       T02918                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04218  Cellular senescence
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04370  VEGF signaling pathway
mcf04371  Apelin signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04620  Toll-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04728  Dopaminergic synapse
mcf04910  Insulin signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04926  Relaxin signaling pathway
mcf04929  GnRH secretion
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04935  Growth hormone synthesis, secretion and action
mcf04973  Carbohydrate digestion and absorption
mcf05010  Alzheimer disease
mcf05017  Spinocerebellar ataxia
mcf05132  Salmonella infection
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05205  Proteoglycans in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05415  Diabetic cardiomyopathy
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102132744 (AKT2)
   04012 ErbB signaling pathway
    102132744 (AKT2)
   04014 Ras signaling pathway
    102132744 (AKT2)
   04015 Rap1 signaling pathway
    102132744 (AKT2)
   04370 VEGF signaling pathway
    102132744 (AKT2)
   04371 Apelin signaling pathway
    102132744 (AKT2)
   04630 JAK-STAT signaling pathway
    102132744 (AKT2)
   04668 TNF signaling pathway
    102132744 (AKT2)
   04066 HIF-1 signaling pathway
    102132744 (AKT2)
   04068 FoxO signaling pathway
    102132744 (AKT2)
   04072 Phospholipase D signaling pathway
    102132744 (AKT2)
   04071 Sphingolipid signaling pathway
    102132744 (AKT2)
   04024 cAMP signaling pathway
    102132744 (AKT2)
   04022 cGMP-PKG signaling pathway
    102132744 (AKT2)
   04151 PI3K-Akt signaling pathway
    102132744 (AKT2)
   04152 AMPK signaling pathway
    102132744 (AKT2)
   04150 mTOR signaling pathway
    102132744 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102132744 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102132744 (AKT2)
   04218 Cellular senescence
    102132744 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102132744 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102132744 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102132744 (AKT2)
   04613 Neutrophil extracellular trap formation
    102132744 (AKT2)
   04620 Toll-like receptor signaling pathway
    102132744 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102132744 (AKT2)
   04660 T cell receptor signaling pathway
    102132744 (AKT2)
   04662 B cell receptor signaling pathway
    102132744 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102132744 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102132744 (AKT2)
   04062 Chemokine signaling pathway
    102132744 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102132744 (AKT2)
   04922 Glucagon signaling pathway
    102132744 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102132744 (AKT2)
   04920 Adipocytokine signaling pathway
    102132744 (AKT2)
   04929 GnRH secretion
    102132744 (AKT2)
   04915 Estrogen signaling pathway
    102132744 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102132744 (AKT2)
   04917 Prolactin signaling pathway
    102132744 (AKT2)
   04926 Relaxin signaling pathway
    102132744 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102132744 (AKT2)
   04919 Thyroid hormone signaling pathway
    102132744 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102132744 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102132744 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102132744 (AKT2)
   04728 Dopaminergic synapse
    102132744 (AKT2)
   04722 Neurotrophin signaling pathway
    102132744 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102132744 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102132744 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102132744 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102132744 (AKT2)
   05205 Proteoglycans in cancer
    102132744 (AKT2)
   05230 Central carbon metabolism in cancer
    102132744 (AKT2)
   05231 Choline metabolism in cancer
    102132744 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102132744 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102132744 (AKT2)
   05212 Pancreatic cancer
    102132744 (AKT2)
   05225 Hepatocellular carcinoma
    102132744 (AKT2)
   05226 Gastric cancer
    102132744 (AKT2)
   05214 Glioma
    102132744 (AKT2)
   05221 Acute myeloid leukemia
    102132744 (AKT2)
   05220 Chronic myeloid leukemia
    102132744 (AKT2)
   05218 Melanoma
    102132744 (AKT2)
   05211 Renal cell carcinoma
    102132744 (AKT2)
   05215 Prostate cancer
    102132744 (AKT2)
   05213 Endometrial cancer
    102132744 (AKT2)
   05224 Breast cancer
    102132744 (AKT2)
   05222 Small cell lung cancer
    102132744 (AKT2)
   05223 Non-small cell lung cancer
    102132744 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102132744 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102132744 (AKT2)
   05161 Hepatitis B
    102132744 (AKT2)
   05160 Hepatitis C
    102132744 (AKT2)
   05164 Influenza A
    102132744 (AKT2)
   05162 Measles
    102132744 (AKT2)
   05168 Herpes simplex virus 1 infection
    102132744 (AKT2)
   05163 Human cytomegalovirus infection
    102132744 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102132744 (AKT2)
   05169 Epstein-Barr virus infection
    102132744 (AKT2)
   05165 Human papillomavirus infection
    102132744 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102132744 (AKT2)
   05135 Yersinia infection
    102132744 (AKT2)
   05152 Tuberculosis
    102132744 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102132744 (AKT2)
   05142 Chagas disease
    102132744 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102132744 (AKT2)
   05017 Spinocerebellar ataxia
    102132744 (AKT2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102132744 (AKT2)
   05418 Fluid shear stress and atherosclerosis
    102132744 (AKT2)
   05415 Diabetic cardiomyopathy
    102132744 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102132744 (AKT2)
   04931 Insulin resistance
    102132744 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102132744 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102132744 (AKT2)
   01524 Platinum drug resistance
    102132744 (AKT2)
   01522 Endocrine resistance
    102132744 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102132744 (AKT2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102132744 (AKT2)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102132744 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1
Other DBs
NCBI-GeneID: 102132744
NCBI-ProteinID: XP_005589304
UniProt: A0A2K5WA10
Position
19
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag
aggcccgaggcccctgatcagacccttccccccttaaacaacttctctgtagcagaatgc
cagctgatgaagaccgagaggccgcggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagacgagagggaggaatggatg
cgggccatccagatggttgccaacagcctcaagcagcgggccccaggtgaggaccccatg
gactacaagtgtggctcccccagtgactcctccgcggccgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgatttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc
tcggctcttgagtacttgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagtgacggggctaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtactttgat
gatgaattcaccgcccagtccatcacaatcacaccccccgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Macaca fascicularis (crab-eating macaque): 102142406
Entry
102142406         CDS       T02918                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04218  Cellular senescence
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04370  VEGF signaling pathway
mcf04371  Apelin signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04620  Toll-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04728  Dopaminergic synapse
mcf04910  Insulin signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04926  Relaxin signaling pathway
mcf04929  GnRH secretion
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04935  Growth hormone synthesis, secretion and action
mcf04973  Carbohydrate digestion and absorption
mcf05010  Alzheimer disease
mcf05017  Spinocerebellar ataxia
mcf05132  Salmonella infection
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05205  Proteoglycans in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05415  Diabetic cardiomyopathy
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102142406 (AKT1)
   04012 ErbB signaling pathway
    102142406 (AKT1)
   04014 Ras signaling pathway
    102142406 (AKT1)
   04015 Rap1 signaling pathway
    102142406 (AKT1)
   04370 VEGF signaling pathway
    102142406 (AKT1)
   04371 Apelin signaling pathway
    102142406 (AKT1)
   04630 JAK-STAT signaling pathway
    102142406 (AKT1)
   04668 TNF signaling pathway
    102142406 (AKT1)
   04066 HIF-1 signaling pathway
    102142406 (AKT1)
   04068 FoxO signaling pathway
    102142406 (AKT1)
   04072 Phospholipase D signaling pathway
    102142406 (AKT1)
   04071 Sphingolipid signaling pathway
    102142406 (AKT1)
   04024 cAMP signaling pathway
    102142406 (AKT1)
   04022 cGMP-PKG signaling pathway
    102142406 (AKT1)
   04151 PI3K-Akt signaling pathway
    102142406 (AKT1)
   04152 AMPK signaling pathway
    102142406 (AKT1)
   04150 mTOR signaling pathway
    102142406 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102142406 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102142406 (AKT1)
   04218 Cellular senescence
    102142406 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102142406 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102142406 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102142406 (AKT1)
   04613 Neutrophil extracellular trap formation
    102142406 (AKT1)
   04620 Toll-like receptor signaling pathway
    102142406 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102142406 (AKT1)
   04660 T cell receptor signaling pathway
    102142406 (AKT1)
   04662 B cell receptor signaling pathway
    102142406 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102142406 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102142406 (AKT1)
   04062 Chemokine signaling pathway
    102142406 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102142406 (AKT1)
   04922 Glucagon signaling pathway
    102142406 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102142406 (AKT1)
   04920 Adipocytokine signaling pathway
    102142406 (AKT1)
   04929 GnRH secretion
    102142406 (AKT1)
   04915 Estrogen signaling pathway
    102142406 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102142406 (AKT1)
   04917 Prolactin signaling pathway
    102142406 (AKT1)
   04926 Relaxin signaling pathway
    102142406 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102142406 (AKT1)
   04919 Thyroid hormone signaling pathway
    102142406 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102142406 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102142406 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102142406 (AKT1)
   04728 Dopaminergic synapse
    102142406 (AKT1)
   04722 Neurotrophin signaling pathway
    102142406 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102142406 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102142406 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102142406 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102142406 (AKT1)
   05205 Proteoglycans in cancer
    102142406 (AKT1)
   05230 Central carbon metabolism in cancer
    102142406 (AKT1)
   05231 Choline metabolism in cancer
    102142406 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102142406 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102142406 (AKT1)
   05212 Pancreatic cancer
    102142406 (AKT1)
   05225 Hepatocellular carcinoma
    102142406 (AKT1)
   05226 Gastric cancer
    102142406 (AKT1)
   05214 Glioma
    102142406 (AKT1)
   05221 Acute myeloid leukemia
    102142406 (AKT1)
   05220 Chronic myeloid leukemia
    102142406 (AKT1)
   05218 Melanoma
    102142406 (AKT1)
   05211 Renal cell carcinoma
    102142406 (AKT1)
   05215 Prostate cancer
    102142406 (AKT1)
   05213 Endometrial cancer
    102142406 (AKT1)
   05224 Breast cancer
    102142406 (AKT1)
   05222 Small cell lung cancer
    102142406 (AKT1)
   05223 Non-small cell lung cancer
    102142406 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102142406 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102142406 (AKT1)
   05161 Hepatitis B
    102142406 (AKT1)
   05160 Hepatitis C
    102142406 (AKT1)
   05164 Influenza A
    102142406 (AKT1)
   05162 Measles
    102142406 (AKT1)
   05168 Herpes simplex virus 1 infection
    102142406 (AKT1)
   05163 Human cytomegalovirus infection
    102142406 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102142406 (AKT1)
   05169 Epstein-Barr virus infection
    102142406 (AKT1)
   05165 Human papillomavirus infection
    102142406 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102142406 (AKT1)
   05135 Yersinia infection
    102142406 (AKT1)
   05152 Tuberculosis
    102142406 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102142406 (AKT1)
   05142 Chagas disease
    102142406 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102142406 (AKT1)
   05017 Spinocerebellar ataxia
    102142406 (AKT1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102142406 (AKT1)
   05418 Fluid shear stress and atherosclerosis
    102142406 (AKT1)
   05415 Diabetic cardiomyopathy
    102142406 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102142406 (AKT1)
   04931 Insulin resistance
    102142406 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102142406 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102142406 (AKT1)
   01524 Platinum drug resistance
    102142406 (AKT1)
   01522 Endocrine resistance
    102142406 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102142406 (AKT1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102142406 (AKT1)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102142406 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102142406
NCBI-ProteinID: XP_005562407
UniProt: G7PBQ9 A0A2K5UY71
Position
7
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKHEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcgaccacgctacttcctcctcaagaatgatggcactttcattggctataaggag
cggccgcaggacgtggaccaacgtgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccacgtggagactcccgaggagcgggaggagtggaca
accgccatccagacagtggccgatggcctcaagaagcacgaggaggagatgatggacttc
cggtcgggctcacccagcgacaactcaggggctgaagagatggaggtgtccctggccaaa
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcgggaaggtgatcctggtgaaggagaaggcaacgggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgt
gttctgcagaactccaggcaccccttcctcacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaatgggggcgagctcttcttccacctgtcc
cgggagcgtgtgttctctgaggaccgggcccgcttctatggcgccgagatcgtgtcagcc
ctggactacctgcactcggagaagaatgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggcgccaccatgaagaccttctgcggcacacctgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcggtggactggtgggggctgggcgtggtcatgtat
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcctgaagccaagtccttgctc
tcagggctgctcaagaaggaccccaagcagaggcttggcgggggctctgaggacgccaag
gagatcatgcagcatcgcttctttgccggcatcgtgtggcagcacgtgtatgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagaccgacaccaggtattttgatgag
gagttcacagcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgc
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Macaca fascicularis (crab-eating macaque): 102144461
Entry
102144461         CDS       T02918                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04218  Cellular senescence
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04370  VEGF signaling pathway
mcf04371  Apelin signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04620  Toll-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04728  Dopaminergic synapse
mcf04910  Insulin signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04926  Relaxin signaling pathway
mcf04929  GnRH secretion
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04935  Growth hormone synthesis, secretion and action
mcf04973  Carbohydrate digestion and absorption
mcf05010  Alzheimer disease
mcf05017  Spinocerebellar ataxia
mcf05132  Salmonella infection
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05205  Proteoglycans in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05415  Diabetic cardiomyopathy
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102144461 (AKT3)
   04012 ErbB signaling pathway
    102144461 (AKT3)
   04014 Ras signaling pathway
    102144461 (AKT3)
   04015 Rap1 signaling pathway
    102144461 (AKT3)
   04370 VEGF signaling pathway
    102144461 (AKT3)
   04371 Apelin signaling pathway
    102144461 (AKT3)
   04630 JAK-STAT signaling pathway
    102144461 (AKT3)
   04668 TNF signaling pathway
    102144461 (AKT3)
   04066 HIF-1 signaling pathway
    102144461 (AKT3)
   04068 FoxO signaling pathway
    102144461 (AKT3)
   04072 Phospholipase D signaling pathway
    102144461 (AKT3)
   04071 Sphingolipid signaling pathway
    102144461 (AKT3)
   04024 cAMP signaling pathway
    102144461 (AKT3)
   04022 cGMP-PKG signaling pathway
    102144461 (AKT3)
   04151 PI3K-Akt signaling pathway
    102144461 (AKT3)
   04152 AMPK signaling pathway
    102144461 (AKT3)
   04150 mTOR signaling pathway
    102144461 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102144461 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102144461 (AKT3)
   04218 Cellular senescence
    102144461 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102144461 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102144461 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102144461 (AKT3)
   04613 Neutrophil extracellular trap formation
    102144461 (AKT3)
   04620 Toll-like receptor signaling pathway
    102144461 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102144461 (AKT3)
   04660 T cell receptor signaling pathway
    102144461 (AKT3)
   04662 B cell receptor signaling pathway
    102144461 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102144461 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102144461 (AKT3)
   04062 Chemokine signaling pathway
    102144461 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102144461 (AKT3)
   04922 Glucagon signaling pathway
    102144461 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102144461 (AKT3)
   04920 Adipocytokine signaling pathway
    102144461 (AKT3)
   04929 GnRH secretion
    102144461 (AKT3)
   04915 Estrogen signaling pathway
    102144461 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102144461 (AKT3)
   04917 Prolactin signaling pathway
    102144461 (AKT3)
   04926 Relaxin signaling pathway
    102144461 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102144461 (AKT3)
   04919 Thyroid hormone signaling pathway
    102144461 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102144461 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102144461 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102144461 (AKT3)
   04728 Dopaminergic synapse
    102144461 (AKT3)
   04722 Neurotrophin signaling pathway
    102144461 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102144461 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102144461 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102144461 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102144461 (AKT3)
   05205 Proteoglycans in cancer
    102144461 (AKT3)
   05230 Central carbon metabolism in cancer
    102144461 (AKT3)
   05231 Choline metabolism in cancer
    102144461 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102144461 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102144461 (AKT3)
   05212 Pancreatic cancer
    102144461 (AKT3)
   05225 Hepatocellular carcinoma
    102144461 (AKT3)
   05226 Gastric cancer
    102144461 (AKT3)
   05214 Glioma
    102144461 (AKT3)
   05221 Acute myeloid leukemia
    102144461 (AKT3)
   05220 Chronic myeloid leukemia
    102144461 (AKT3)
   05218 Melanoma
    102144461 (AKT3)
   05211 Renal cell carcinoma
    102144461 (AKT3)
   05215 Prostate cancer
    102144461 (AKT3)
   05213 Endometrial cancer
    102144461 (AKT3)
   05224 Breast cancer
    102144461 (AKT3)
   05222 Small cell lung cancer
    102144461 (AKT3)
   05223 Non-small cell lung cancer
    102144461 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102144461 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102144461 (AKT3)
   05161 Hepatitis B
    102144461 (AKT3)
   05160 Hepatitis C
    102144461 (AKT3)
   05164 Influenza A
    102144461 (AKT3)
   05162 Measles
    102144461 (AKT3)
   05168 Herpes simplex virus 1 infection
    102144461 (AKT3)
   05163 Human cytomegalovirus infection
    102144461 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102144461 (AKT3)
   05169 Epstein-Barr virus infection
    102144461 (AKT3)
   05165 Human papillomavirus infection
    102144461 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102144461 (AKT3)
   05135 Yersinia infection
    102144461 (AKT3)
   05152 Tuberculosis
    102144461 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102144461 (AKT3)
   05142 Chagas disease
    102144461 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102144461 (AKT3)
   05017 Spinocerebellar ataxia
    102144461 (AKT3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102144461 (AKT3)
   05418 Fluid shear stress and atherosclerosis
    102144461 (AKT3)
   05415 Diabetic cardiomyopathy
    102144461 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102144461 (AKT3)
   04931 Insulin resistance
    102144461 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102144461 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102144461 (AKT3)
   01524 Platinum drug resistance
    102144461 (AKT3)
   01522 Endocrine resistance
    102144461 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102144461 (AKT3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102144461 (AKT3)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102144461 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1 PH_11
Other DBs
NCBI-GeneID: 102144461
NCBI-ProteinID: XP_005539712
UniProt: G7NWL3 A0A2K5V8I7
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccaa
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagatcgtgtaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaagtttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcagttttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system