KEGG   Macaca fascicularis (crab-eating macaque): 102133065
Entry
102133065         CDS       T02918                                 

Gene name
CD3E
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf05142  Chagas disease
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133065 (CD3E)
   04660 T cell receptor signaling pathway
    102133065 (CD3E)
   04658 Th1 and Th2 cell differentiation
    102133065 (CD3E)
   04659 Th17 cell differentiation
    102133065 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102133065 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102133065 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    102133065 (CD3E)
   05162 Measles
    102133065 (CD3E)
   05169 Epstein-Barr virus infection
    102133065 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102133065 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    102133065 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102133065 (CD3E)
CD molecules [BR:mcf04090]
 Proteins
  102133065 (CD3E)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 P5-ATPase
Other DBs
NCBI-GeneID: 102133065
NCBI-ProteinID: NP_001270544
UniProt: Q95LI5
Position
14
AA seq 198 aa
MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQ
HNGKNKGDSGDQLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMA
VATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYE
PIRKGQQDLYSGLNQRRI
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcagtcgggcactcgctggagagttctgggcctctgcctcttatcaattggcgtttgg
gggcaagatggtaatgaagaaatgggtagtattacacagacaccatatcaagtctccatc
tctggaaccacagtaatactgacatgctctcagcatcttggatctgaagcacaatggcaa
cacaatggtaaaaacaaaggagattctggggatcaactgtttctgccggaattttcagaa
atggagcaaagtggttattatgtctgctaccccagaggaagcaatccagaggacgcgagc
catcatctctacctgaaggcaagagtgtgtgagaactgcatggagatggatgtgatggcg
gtggccacaattgtcatagtggacatctgcatcactctgggcttgctgctgctggtttac
tactggagcaagaatagaaaggccaaggccaagcctgtgacacgaggagcaggtgctggc
ggcaggcaaaggggacaaaacaaggagaggccaccacctgttcccaacccagactatgag
cccatccggaaaggccagcaggatctgtattctggcctgaatcagagacgcatctga

KEGG   Macaca fascicularis (crab-eating macaque): 102133701
Entry
102133701         CDS       T02918                                 

Gene name
CD3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf05142  Chagas disease
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133701 (CD3D)
   04660 T cell receptor signaling pathway
    102133701 (CD3D)
   04658 Th1 and Th2 cell differentiation
    102133701 (CD3D)
   04659 Th17 cell differentiation
    102133701 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102133701 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102133701 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    102133701 (CD3D)
   05162 Measles
    102133701 (CD3D)
   05169 Epstein-Barr virus infection
    102133701 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102133701 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    102133701 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102133701 (CD3D)
CD molecules [BR:mcf04090]
 Proteins
  102133701 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Other DBs
NCBI-GeneID: 102133701
NCBI-ProteinID: NP_001274617
UniProt: Q95LI8 G7PP34
Position
14
AA seq 171 aa
MEHSTFLSGLVLATLLSQVSPFKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDL
GKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSRLGGNWARNK
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaacatagcacgtttctgtctggcctggtactggctacccttctctcccaagtgagc
cccttcaagatacctgtagaggaacttgaggacagagtgtttgtgaaatgcaataccagc
gtcacatgggtagagggaacggtgggaacactgctcacaaataatacaagactggacctg
ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatatatacaag
gacaaagaatctgctgtgcaagttcattatcgaatgtgccagaactgtgtggagctggat
ccagccaccctggctggcatcattgtcactgatgtcattgccactctgctccttgctttg
ggagtcttctgctttgctggacatgagactggaaggctctctggggctgccgacacacaa
gctctattgaggaatgaccaggtctatcagcccctccgagatcgagatgatgctcagtac
agccgccttggaggaaactgggctcggaacaagtga

KEGG   Macaca fascicularis (crab-eating macaque): 102134381
Entry
102134381         CDS       T02918                                 

Gene name
CD3G
Definition
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf05142  Chagas disease
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102134381 (CD3G)
   04660 T cell receptor signaling pathway
    102134381 (CD3G)
   04658 Th1 and Th2 cell differentiation
    102134381 (CD3G)
   04659 Th17 cell differentiation
    102134381 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102134381 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102134381 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    102134381 (CD3G)
   05162 Measles
    102134381 (CD3G)
   05169 Epstein-Barr virus infection
    102134381 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102134381 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102134381 (CD3G)
CD molecules [BR:mcf04090]
 Proteins
  102134381 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_2 Ig_3 ig KGK
Other DBs
NCBI-GeneID: 102134381
NCBI-ProteinID: NP_001270839
UniProt: Q95LI7
Position
14
AA seq 181 aa
MVQGKGLTGFILAIILLQGSLAQSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKM
IDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAATILGFVFA
EIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRM
N
NT seq 546 nt   +upstreamnt  +downstreamnt
atggttcaggggaagggcctgactggcttcatcctggctatcattcttcttcaaggtagt
ttggcccaatcatttgaagaaaaccgcaagcttaacgtgtataaccaagaagatggttca
gtacttctgacttgtcatgtgaaaaacacaaatatcacatggtttaaagaagggaagatg
atagacatcctaactgcacataaaaataaatggaatctgggaagtaataccaaggaccct
cgaggggtgtatcagtgtaaaggatcaaaggacaagtcaaaaacactccaagtgtattac
agaatgtgtcagaactgcattgaactaaatgcagccaccatattgggctttgtctttgct
gaaatcatcagcattttcttccttgctgttggggtctacttcattgctggacaggatgga
gttcgccagtcgagagcttcagacaagcagactctgttgcctaatgaccagctctaccag
cccctcaaggatcgagaagatgaccagtacagtcaccttcaagggaaccagttgaggatg
aattga

DBGET integrated database retrieval system