KEGG   Macaca fascicularis (crab-eating macaque): 102133459
Entry
102133459         CDS       T02918                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102133459 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102133459 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133459 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102133459 (IL11RA)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL6/12 receptor family
   102133459 (IL11RA)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig EpoR_lig-bind I-set
Other DBs
NCBI-GeneID: 102133459
NCBI-ProteinID: XP_005581498
UniProt: A0A2K5VLM5
Position
15
AA seq 422 aa
MSSGCSGLSRVLVAVATALVSASSSCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPRLLQGPDSGLGHELVLTQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGFPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEMITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTVPKEVPAWGQLHMQPEVEPQVDSPAPPSPSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLMAGALALGLWLRMRRGGKDGSPKPGFLAPMIPVDRRPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcggctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctcctcctgcccccaggcctggggccccccaggggtccagtatgggcagccc
ggcaggtccgtgaagctgtgttgtcctggagtgactgctggggacccagtgtcctggttt
cgggacggggagccaaggctgctccagggacctgactctgggctagggcatgaactggtc
ctgacccaggcagacagcactgatgagggcacctacatctgccagacgctggatggtgca
cttgggggcacagtgaccctgcagctgggctaccctccagcccgccctgttgtctcctgc
caagcagctgactatgagaacttctcttgcacttggagtcccagccagatcagcggttta
cccacccgctacctcacctcctacaggaagaagacagttctaggagctgatagccagagg
aggagtccatccacagggccctggccatgcccacaggatcccttaggtgctgcccgctgt
gttgtccacggggctgagttctggagccagtaccggattaatgtgactgaggtgaaccca
ctgggcgccagcacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
ccccagggcctgcgggtagagtcggtaccaggtttcccccgacgcctgcgagccagctgg
acataccctgcctcctggccgcgccagccccatttcctgctcaagttccgtttgcagtac
cgtccggcacagcatccagcctggtccacggtggagccagctggactggaggagatgatc
acagatgctgtggctgggctgccccatgccgtacgagtcagtgcccgggactttctggat
gctggcacctggagcacctggagcccggaggcctggggaactccgagcactgggaccgta
ccaaaggaggtaccagcttggggccagctacacatgcagccagaggtggagcctcaggtg
gatagccctgctcctccaagcccctccctccaaccacaccctcggctacttgatcacagg
gactctgtggagcaggtagctgtgctggcgtctttgggaatcctttcttttctgggactg
atggctggagccctggcactggggctctggctgaggatgagacggggcgggaaggatgga
tccccaaagcctgggttcttggccccaatgattccagtggacaggcgtccaggagctcca
aacctatag

DBGET integrated database retrieval system