KEGG   Macaca fascicularis (crab-eating macaque): 102133649
Entry
102133649         CDS       T02918                                 

Gene name
IL4R, IL-4R
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf05200  Pathways in cancer
mcf05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102133649 (IL4R)
   04151 PI3K-Akt signaling pathway
    102133649 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102133649 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133649 (IL4R)
   04658 Th1 and Th2 cell differentiation
    102133649 (IL4R)
   04659 Th17 cell differentiation
    102133649 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102133649 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102133649 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102133649 (IL4R)
   04090 CD molecules [BR:mcf04090]
    102133649 (IL4R)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL2 receptor family
   102133649 (IL4R)
CD molecules [BR:mcf04090]
 Proteins
  102133649 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 102133649
NCBI-ProteinID: XP_005591572
Position
20
AA seq 832 aa
MGWLCSGLLFPVSCLVLLQVASSGCSCVSPGSMKVLQEPTCVSDYMSISTCEWKMGGPTN
CSAELRLLYQLVFQSSETHTCVPENNGGVGCVCHLLMDDVVSMDNYTLDLWAGQQLLWKG
SFKPSEHVKPRAPGNLTVHTNVSDTVLLTWSNPYPPDNYLYNDLTYAVNIWSENDPAYSR
IHNVTYLKPTLRIPASTLKSGISYRARVRAWAQHYNTTWSEWSPSTKWYNSYREPFEQRL
LWGVSAACVFILFFCLSCYFSVTKIKKEWWDQIPNPARSHLVAIIIQDAQESQWEKRSRG
QEAAKCPYWKNCLTKLLPCFLEHNMKRDEDPHKAVKDLPFRGSGKSAWCPVEISNTVLWP
ESISVVRCVELFEAPVECKEEEEVEEEKGSFCISSESNRDDFQEGREGIVARLTESLFLD
LLGGENGGFFQQDMGESCLLPPLGSTSAHVPWDEFPSAGPKEVPPWGKEQPLHQEPSPPA
SPTQSPDNPTCTEMPLVISSNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVDPEMPCD
PQLSEPTTVAPAEPETWEQILRRNVLQHGAAAAPASAPTSGYREFVHAVQQGGIQASAVA
GLGPPGEAGYKAFSSLLASSAVSLGECGFGASSGEEGYKPFQDLTPGCPGDPAPVPVPLF
TFGLDREPPHSPQSSHLPSNSPEHLALEPGEKVEDMQKPPLPPEQATDPLGDNLGSGIVY
SALTCHLCGHLKQCHGQEDGGQAPVVASPCCGCCCGDRSSPPTTPLRAPDPSLGGVPLEA
SLCPASLAPSGISEKSKSSLSFHPAPGSAQSSSQTPQIVNFVSVGPTCMRVS
NT seq 2499 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctggctgctcctgtgtctccccagggagcatgaaggtcctgcaggagcccacc
tgcgtctccgactacatgagcatctctacctgtgagtggaagatgggcggtcccaccaat
tgcagcgccgagctccgtctgttgtaccagctggtttttcagtcctccgaaacccacacg
tgtgtccccgagaacaacggcggtgtggggtgcgtgtgccacctgctcatggatgatgtg
gtcagtatggacaactatacgctggacctgtgggctggacagcagctgctgtggaagggc
tccttcaagcccagcgagcatgtgaaacccagggccccaggaaacctcacggttcacacc
aatgtctccgacactgtgctgctgacctggagcaacccgtatccccctgacaattacctg
tataatgatctcacctatgcagtcaacatttggagtgaaaacgacccggcatattccaga
atccataacgtgacctacctaaaacccaccctccgcatcccagccagcaccctgaagtct
ggaatttcctacagggcacgggtgagggcctgggctcagcactataacaccacctggagt
gagtggagccccagcaccaagtggtacaactcctacagggagcccttcgagcagcgcctc
ctgtggggtgtcagcgccgcctgcgttttcatcctgttcttctgcctgtcgtgctatttc
agcgtcaccaagattaagaaagaatggtgggaccagattcccaacccagcccgcagccac
ctcgtggctataataatccaggatgctcaggagtcacagtgggagaagcgatcccgaggc
caggaagcagccaaatgcccatactggaagaattgtcttaccaagctcttgccctgtttt
ctggagcacaacatgaaaagggatgaggatccccacaaggctgtcaaagatctgccattc
cggggctccggaaaatcagcatggtgcccggtggagatcagcaacacagtcctctggcca
gagagcatcagcgtggtgcgatgcgtggagttgtttgaggctccagtggagtgtaaggag
gaggaggaggtagaggaagaaaaagggagcttctgtatatcatctgagagcaatagggat
gacttccaggagggaagggagggtattgtggcccggctaacagagagcctgttcctggac
ctgctcggaggggagaatgggggctttttccagcaggacatgggggagtcgtgccttctt
ccacctttgggaagcacgagtgctcacgtgccctgggatgagttcccaagtgcagggccc
aaggaggtgcctccctggggcaaggagcagcctctccaccaggagccgagtcctcctgcc
agcccaacgcagagcccagacaacccgacttgcacagagatgcccctcgtcatctcaagc
aaccctgcttaccgtagcttcagcaactccctgagccagtccccatgtcccagagagctg
ggtccagacccgctgctggccagacatctggaggaagtggaccctgagatgccctgtgac
ccccagctctctgagccaaccactgtggccccagctgagccagaaacctgggagcagatc
ctccgtcggaatgtcctccagcacggggcggctgcagcccccgcctcggcccccaccagt
ggctatcgcgagtttgtacatgcggtgcagcagggtggcatccaggccagtgcggtggcg
ggcttgggccccccgggagaggctgggtacaaggccttctcgagcctgcttgccagcagt
gccgtgtccctgggggaatgtggatttggggctagcagtggggaagaggggtataagcct
ttccaagacctcactcctggctgccccggggaccctgccccagtccctgtccccttgttc
acctttggactggacagggagccacctcacagcccgcagagctcacacctcccaagcaac
tccccagagcacctggctctggaaccaggggaaaaagtagaggacatgcaaaagccccca
ctccccccggagcaggccacagacccccttggggacaacctgggcagtggcatcgtctac
tcagccctcacctgccacctgtgcggccacctgaagcagtgtcatggccaggaggatggt
ggccaggcccctgtcgtggccagtccctgctgtggctgctgctgtggagacaggtcctcg
ccccctacaacccccctgagggccccagacccctctctaggtggggttccactggaggcc
agcctctgtccggcctccctggcaccctcgggcatctcagagaagagtaaatcctcactg
tccttccatcctgcccctggcagtgctcagagctcaagccagactccccagatcgtgaac
tttgtctccgtgggtcccacatgcatgagggtctcttag

DBGET integrated database retrieval system