KEGG   Macaca fascicularis (crab-eating macaque): 102135001
Entry
102135001         CDS       T02918                                 

Gene name
IL7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102135001 (IL7)
   04151 PI3K-Akt signaling pathway
    102135001 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102135001 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102135001 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102135001 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102135001 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102135001 (IL7)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102135001 (IL7)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Cytokines
   102135001 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 102135001
NCBI-ProteinID: XP_005563650
UniProt: A0A2K5W745
Position
8
AA seq 177 aa
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHLCDDNKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGK
VKGRKPAALGEAQPTKSLEENKSLKEQKKLNDSCFLKRLLQKIKTCWNKILMGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatctatgtgatgataataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcaccggcaag
gttaaaggaagaaaaccagctgccctgggtgaagcccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgactcatgtttcctaaagagactacta
caaaagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

DBGET integrated database retrieval system