KEGG   Macaca fascicularis (crab-eating macaque): 102135998
Entry
102135998         CDS       T02918                                 

Gene name
TP53, p53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04010  MAPK signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04110  Cell cycle
mcf04115  p53 signaling pathway
mcf04137  Mitophagy - animal
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04216  Ferroptosis
mcf04218  Cellular senescence
mcf04310  Wnt signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf05012  Parkinson disease
mcf05014  Amyotrophic lateral sclerosis
mcf05016  Huntington disease
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05210  Colorectal cancer
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05216  Thyroid cancer
mcf05217  Basal cell carcinoma
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102135998 (TP53)
   04310 Wnt signaling pathway
    102135998 (TP53)
   04071 Sphingolipid signaling pathway
    102135998 (TP53)
   04151 PI3K-Akt signaling pathway
    102135998 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102135998 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102135998 (TP53)
   04210 Apoptosis
    102135998 (TP53)
   04216 Ferroptosis
    102135998 (TP53)
   04115 p53 signaling pathway
    102135998 (TP53)
   04218 Cellular senescence
    102135998 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102135998 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102135998 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102135998 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102135998 (TP53)
   05202 Transcriptional misregulation in cancer
    102135998 (TP53)
   05206 MicroRNAs in cancer
    102135998 (TP53)
   05205 Proteoglycans in cancer
    102135998 (TP53)
   05203 Viral carcinogenesis
    102135998 (TP53)
   05230 Central carbon metabolism in cancer
    102135998 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102135998 (TP53)
   05212 Pancreatic cancer
    102135998 (TP53)
   05225 Hepatocellular carcinoma
    102135998 (TP53)
   05226 Gastric cancer
    102135998 (TP53)
   05214 Glioma
    102135998 (TP53)
   05216 Thyroid cancer
    102135998 (TP53)
   05220 Chronic myeloid leukemia
    102135998 (TP53)
   05217 Basal cell carcinoma
    102135998 (TP53)
   05218 Melanoma
    102135998 (TP53)
   05219 Bladder cancer
    102135998 (TP53)
   05215 Prostate cancer
    102135998 (TP53)
   05213 Endometrial cancer
    102135998 (TP53)
   05224 Breast cancer
    102135998 (TP53)
   05222 Small cell lung cancer
    102135998 (TP53)
   05223 Non-small cell lung cancer
    102135998 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102135998 (TP53)
   05161 Hepatitis B
    102135998 (TP53)
   05160 Hepatitis C
    102135998 (TP53)
   05162 Measles
    102135998 (TP53)
   05168 Herpes simplex virus 1 infection
    102135998 (TP53)
   05163 Human cytomegalovirus infection
    102135998 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102135998 (TP53)
   05169 Epstein-Barr virus infection
    102135998 (TP53)
   05165 Human papillomavirus infection
    102135998 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102135998 (TP53)
   05014 Amyotrophic lateral sclerosis
    102135998 (TP53)
   05016 Huntington disease
    102135998 (TP53)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102135998 (TP53)
   05418 Fluid shear stress and atherosclerosis
    102135998 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102135998 (TP53)
   01522 Endocrine resistance
    102135998 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102135998 (TP53)
   03036 Chromosome and associated proteins [BR:mcf03036]
    102135998 (TP53)
   03400 DNA repair and recombination proteins [BR:mcf03400]
    102135998 (TP53)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102135998 (TP53)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102135998 (TP53)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102135998 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 102135998
NCBI-ProteinID: NP_001274608
UniProt: P56423 G7PTI9
Position
16
AA seq 393 aa
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcatcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcagtg
gatgatttgatgctgtctccagacgatcttgcacaatggttaactgaagacccaggtcca
gatgaagctccgagaatgtcagaggctgctccccccatggcccccacaccagcagctcct
acaccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggcagctacggtttccgtctgggcttcctgcattctggaacagccaag
tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc
tgccccgtgcagctatgggttgattccacacccccacccggcagccgcgtccgcgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagacagcgatggactggcccctcctcagcaccttatccgagtggaaggaaat
ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatccttaccattatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccaccagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg
gggagcagggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccat
aaaaaattcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system