KEGG   Macaca fascicularis (crab-eating macaque): 102136007
Entry
102136007         CDS       T02918                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor
  KO
K06503  transferrin receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04066  HIF-1 signaling pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04216  Ferroptosis
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102136007 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102136007 (TFRC)
   04145 Phagosome
    102136007 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    102136007 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136007 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcf01002]
    102136007 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102136007 (TFRC)
   04090 CD molecules [BR:mcf04090]
    102136007 (TFRC)
Peptidases and inhibitors [BR:mcf01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   102136007 (TFRC)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102136007 (TFRC)
  Exosomal proteins of colorectal cancer cells
   102136007 (TFRC)
CD molecules [BR:mcf04090]
 Proteins
  102136007 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer
Other DBs
NCBI-GeneID: 102136007
NCBI-ProteinID: XP_005545315
UniProt: A0A2K5X958
Position
2
AA seq 760 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLGVDEEENTDNNTKANGTKPK
RCGGNICYGTIAVIIFFLIGFMIGYLGYCKGVEPKTECERLAGTESPAREEPEEDFPAAP
RLYWDDLKRKLSEKLDTTDFTSTIKLLNENLYVPREAGSQKDENLALYIENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGGLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLDSPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVKADLSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCKMVTSENKSVKLTVSNVLKETKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSS
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQDVKHPVTGRSLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELVERIPELNKVARAAAEVAGQFVIK
LTHDTELNLDYERYNSQLLLFLRDLNQYRADVKEMGLSLQWLYSARGDFFRATSRLTTDF
RNAEKRDKFVMKKLNDRVMRVEYYFLSPYVSPKESPFRHVFWGSGSHTLSALLESLKLRR
QNNSAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgatggatcaagctagatcagcattctctaacttgtttggtggagaaccattgtcatat
acccgattcagcctggctcggcaagtagacggcgataacagtcatgtggagatgaaactt
ggtgtagatgaagaagaaaatactgacaataacacaaaggccaatggcacaaaaccaaaa
aggtgtggtggaaatatctgctatgggactattgccgtgatcatctttttcttgattggg
tttatgattggctacttgggctattgtaaaggggtagaaccaaaaactgagtgtgagaga
ctagcaggcaccgagtctccagcgagggaggagccagaagaggacttccctgcggcaccg
cgcttatactgggacgacctgaagagaaagttgtcagagaaactggacaccacagacttc
accagcaccatcaagctgctgaatgaaaatttatatgtccctcgtgaggctggatctcaa
aaagatgaaaatcttgcattgtatattgaaaatcaatttcgtgaatttaaactcagcaaa
gtctggcgtgatcaacattttgttaagattcaggtcaaggacagtgctcaaaactcggtg
atcatagttgataagaatggtggacttgtttacctggtggagaatcctgggggttatgtg
gcatatagtaaggctgcaacagttactggtaaactggtccatgctaattttggtactaaa
aaagactttgaggatttagactctcctgtgaatggatctatagtgattgtcagagcagga
aaaatcacctttgcagaaaaggttgcaaatgctgaaagcttaaatgcaattggtgtcttg
atatatatggaccagactaaatttcctattgttaaggcagacctttcattctttggacat
gctcatctgggaacaggtgacccttacacgcctggattcccttccttcaatcacactcag
tttccaccatctcagtcgtcaggattgcctaatatacctgtccaaacgatctccagagct
gctgcagaaaagctgtttggaaatatggagggagactgtccctctgactggaaaacagac
tctacgtgtaagatggtaacctcggaaaacaagagtgtgaagctcacggtgagcaatgtg
ctgaaagagacaaaaattcttaacatctttggagttattaaaggcttcgtagaaccagat
cactatgttgtggttggggcccagagagatgcgtggggccccggagctgcaaaatccagt
gtggggacagctctcctgttgaaacttgcccagatgttctcagatatggtcttaaaagat
gggtttcagcccagcagaagcattatctttgccagttggagtgctggagactttggatcg
gttggtgccactgaatggctagagggatacctttcatccttgcatttaaaggctttcact
tatattaatctggataaagcggtgcttggtaccagcaacttcaaggtttctgccagcccg
ttgttgtatacgctgattgagaaaacaatgcaagatgtgaaacatccggttactgggcga
tctctatatcaggacagcaactgggccagcaaagttgagaaactcactttagacaatgct
gctttccctttccttgcgtattctggaatcccagcagtttctttctgtttttgtgaggac
acagattatccttacttgggcaccaccatggacacctataaggaactggtggagaggatt
cctgagctgaacaaagtggcacgagcagcggcagaagtagctggtcagttcgtgattaaa
ctgacccatgatactgaattgaacctggactatgagaggtacaacagccagctgcttttg
tttttgagggatctgaaccagtacagagcagatgtaaaggaaatgggcctgagcttgcag
tggctgtattctgctcgtggagactttttccgtgctacttccaggctaacaacagatttc
aggaatgctgagaaaagggacaagtttgtcatgaagaagctcaatgatcgtgtcatgaga
gtcgagtattacttcctctcaccctatgtgtctccaaaagagtctcctttccggcacgtc
ttctggggctccggctcccacacgctgtccgctttactggagagcttgaaactgcgtaga
cagaataacagtgcttttaatgaaacgctgttcagaaaccagctggctctcgcgacttgg
actattcagggagctgcaaatgccctttctggtgacgtttgggacattgacaatgagttt
taa

DBGET integrated database retrieval system