KEGG   Macaca fascicularis (crab-eating macaque): 102136514
Entry
102136514         CDS       T02918                                 

Gene name
CD5
Definition
(RefSeq) CD5 molecule
  KO
K06455  T-cell surface glycoprotein CD5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136514 (CD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102136514 (CD5)
CD molecules [BR:mcf04090]
 Proteins
  102136514 (CD5)
SSDB
Motif
Pfam: SRCR Comm
Other DBs
NCBI-GeneID: 102136514
NCBI-ProteinID: XP_005578922
Position
14
AA seq 442 aa
MVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNC
SHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFY
SGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPL
PIQWTIRNSSCTSLEHCFRKIKPRNSGQVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQ
GAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHEL
TERKSYCKKVFVTCQDPNPAGPAAGTVASIILALVLLGVLLVVCGPLAYKKLVKKFRQKK
QRQWIGPTGMNQNMSFHRNHTATVRSHVENPTASHVDNEYSQPPRNSRLSAYPALEGALH
RSSTQPDNSSDSDYDLHGAQRL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggtttgcagccagagctggggccggagctccaaccagtgggaggaccccaatcaagcg
tcaaaagtctgccagcgactgaactgtggggtgcccttaagccttggtcccttccttatc
accgacagacatcagagccaaatcacctgctacggacgcctgggctccttctccaactgc
agccacagcggaagagatgtgtgtcgccctctgggcctgacctgcttagagccccagacg
acaacacctccacccacaaggcccccgcccaccacaactccagagcccacagctcctccc
aggctgcagctggtggcacaggctgcaggccggcactgtgccggcgtggtggagttctac
agcggcagcctggggggtaccatcagctatgaggcccaggacaaggcccaggacaagacc
caggtcctggagaactttctctgcagcagcctccagtgtggctccttcttgaagcatctg
ccagagaccgaggcagccacagcccaagacccaggggagctgcgggaacaccagcccttg
ccaatccaatggacgatccggaactcgagctgtacctccctggagcattgcttccggaaa
atcaagccccgcaacagtggccaagttcttgccctcctctgctcaggtttccagcccaag
gtgcagagccgtctggtagggggcagcagcatctgtgaaggcaccgtggaggtgcgccag
ggggctcagtgggcagccctgtgcgacagctcttcagccaagagctctctgcgatgggag
gaggtatgccgggagcagcagtgtggcagcttcaactcctatcaagcgctggacgctggt
gacccaacatcccgggggctctcctgtccccatcagaagctgtcacagtgccacgaactt
acagagagaaagtcctactgcaagaaggtgtttgtcacatgccaggatccaaatccagca
ggcccagccgcaggcaccgtggcaagcatcatcctggccctggtgctcctgggggtgctg
ctggtcgtgtgcggcccccttgcctacaagaagctggtgaagaaattccgccagaagaag
cagcgccagtggattggcccaacgggaatgaaccagaacatgtccttccatcgcaaccac
acagcaaccgtccggtcccatgttgagaaccccacagcctcccatgtggataacgaatac
agccaacctcccaggaactcccgcctgtcagcttatccagctctggaaggggccctgcat
cgctcgtccacacagcctgacaactcctccgacagtgactacgacctgcacggggctcag
cggctgtaa

DBGET integrated database retrieval system