KEGG   Macaca fascicularis (crab-eating macaque): 102136616
Entry
102136616         CDS       T02918                                 

Gene name
IL9R
Definition
(RefSeq) interleukin 9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102136616 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102136616 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136616 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102136616 (IL9R)
   04090 CD molecules [BR:mcf04090]
    102136616 (IL9R)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL2 receptor family
   102136616 (IL9R)
CD molecules [BR:mcf04090]
 Proteins
  102136616 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 102136616
NCBI-ProteinID: XP_015299829
Position
X
AA seq 525 aa
MGSTPLGRDDLHRPSAQSLAGWTLESEALRRDMGTWLLACTCVCTCVCLGVCVTEEGQGP
RAGNFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILQGSECTVVLPPE
AVLVPSDNFTITFHHCVSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSIS
PALEPMTTLLNYELAFKKQEEAWERAQHRDHIVGVTWLVLEAFELDPGFILEARLRVRMA
TLEDDVAEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGQPDNTLVAVSVFLLLIGLTYL
LFKLSPRVKRIFYQNVPSPAAFFRPLYSVHNGNFQTWMGAHRAGVLLSQDCAGAPRGASE
PCIQEAIALLTCGPVHPWKSVALEEEEEGTGTRLAGNLSSENVLPAGCTEWRAQMLAYLP
QEDWAPTSPTGSAPPDSEGSSSSSSDYCTLGCYGGWHLSALPGNTQSPGPIPALACGLSC
DHQGLETQQGVAWVLAGHCQRPGLHEDLQGMVFPSVLSKARSWTF
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggggagcacccctctagggagggatgatttgcacaggccctcagcccagtcccttgca
ggctggaccttggagagtgaagccctgaggcgagacatgggcacctggctcctggcctgc
acctgcgtctgcacctgtgtctgcttgggagtctgtgtcacagaggaaggacaagggcca
agggctggaaacttcacctgcctcaccaacaacattctcaggatcgattgccactggtct
gccccagagcttggccagggctccagcccctggcttctcttcaccagcaaccaggctccc
ggcggcacacataagtgcatcttgcagggcagtgagtgcaccgtagtgctgccacccgag
gcagtgctcgtgccatccgacaatttcaccatcactttccaccactgcgtgtctggcagg
gagcaggtcagcctggtggacccggagtacctgccccggagacatgttaaactggacccg
ccctctgacttgcagagcaacatcagctctggccactgcatcctgacctggagcatcagt
cctgccttggagccaatgaccacacttctcaactatgaattggccttcaagaagcaggaa
gaggcctgggagcgggcccagcacagggatcacattgtcggggtgacctggctcgtactt
gaagcctttgagctggaccctggctttatccttgaggccaggctgcgtgtccggatggcc
acattggaggatgacgtggcagaggaggagcgttacacaggccagtggagtgagtggagc
cagcctgtgtgcttccaggctccccagagacaaggccctctgatcccaccctgggggcag
ccagacaacacccttgtcgctgtgtccgtcttcctcctgctgattggcctgacttacctc
ctgttcaagctttcacccagggtgaagagaatcttctaccagaacgtgccctctccagcg
gcgttcttccggcccctctacagtgtgcacaatgggaacttccagacttggatgggggcc
cacagggccggtgtgctgctgagccaggactgtgctggcgccccacgaggagcctcggag
ccctgcatccaggaggccattgcactgctaacctgtggcccagtgcatccttggaaatct
gtggccctggaggaggaagaggagggcactgggaccaggcttgcagggaacctgagctca
gagaatgtgctgccagcagggtgtacggagtggagggcacagatgcttgcctatctgcca
caggaggactgggcccccacgtcccccactgggtcagctcccccagactcagagggcagc
agcagcagcagcagtgactactgtactttgggttgctatgggggatggcacctctcagcc
ctcccagggaacacgcagagccctgggcccatcccagccctggcttgtggtctttcctgt
gaccatcagggccttgagacccagcaaggagttgcctgggtgctggctggccactgccag
aggcctgggctgcatgaggacctccagggcatggttttcccttccgtcctcagcaaggct
cggtcctggacattctag

DBGET integrated database retrieval system