KEGG   Macaca fascicularis (crab-eating macaque): 102138718
Entry
102138718         CDS       T02918                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102138718 (EPOR)
   04151 PI3K-Akt signaling pathway
    102138718 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102138718 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102138718 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102138718 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102138718 (EPOR)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  Prolactin receptor family
   102138718 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 102138718
NCBI-ProteinID: XP_005588091
UniProt: A0A2K5WKK4
Position
19
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLVARGPEELLCFTERLEDL
VCFWEEAASAAVSPDNYSFSYHLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRIIHINEVVLLDAPVGLVARLADEGGHIVLRWLPPPEAPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SGHAQDTYLVLDKWLLPRNPPSEDLPGPDGSVDTVVMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWALSPELPSTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgtccttgtggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcccaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggtggcccgcggacccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagtgcggcggtgagcccagacaactacagcttctcc
taccacctcgaggatgagccatggaagctttgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtatcatccacatcaat
gaagtagtgctcctggacgcccccgtggggctggtggcacggctggctgacgagggcggc
cacatagtgttgcgctggctcccgccgcctgaggcacccatgacgtcccacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtgcagagggtggagatcctggag
ggccgcaccgaatgtgtgctgagcaacctgaggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
ctcatcctggtgctgctgaccgtgctcgccctgctgtcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaacgatggctgcctgtggtggagcccctgc
acccccttcacagaggacccacctgcctccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccggtgggc
agtgggcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctgatggcagtgtggacacagtggtcatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcctagcccagagggagcctct
gctgccagcttcgagtacaccatcctggaccccagctcccagctcttgcgtccatgggca
ctgtcccctgagctgccctctaccccaccccacctaaagtacctgtaccttgtcgtatct
gactctggcatctcaactgactatagctcaggggactcccagggagcccaagggggctta
tccgatggcccctactccaacccttatgagaacagccttatcccagccgctgagcctctg
ccccctagctatgtggcttgctcttag

DBGET integrated database retrieval system