KEGG   Macaca fascicularis (crab-eating macaque): 102138837
Entry
102138837         CDS       T02918                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04064  NF-kappa B signaling pathway
mcf04514  Cell adhesion molecules
mcf04650  Natural killer cell mediated cytotoxicity
mcf04668  TNF signaling pathway
mcf04670  Leukocyte transendothelial migration
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05143  African trypanosomiasis
mcf05144  Malaria
mcf05150  Staphylococcus aureus infection
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05323  Rheumatoid arthritis
mcf05416  Viral myocarditis
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102138837 (ICAM1)
   04668 TNF signaling pathway
    102138837 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102138837 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102138837 (ICAM1)
   04670 Leukocyte transendothelial migration
    102138837 (ICAM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138837 (ICAM1)
   05164 Influenza A
    102138837 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138837 (ICAM1)
   05169 Epstein-Barr virus infection
    102138837 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102138837 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    102138837 (ICAM1)
   05143 African trypanosomiasis
    102138837 (ICAM1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102138837 (ICAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102138837 (ICAM1)
   05418 Fluid shear stress and atherosclerosis
    102138837 (ICAM1)
   05416 Viral myocarditis
    102138837 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102138837 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102138837 (ICAM1)
   04090 CD molecules [BR:mcf04090]
    102138837 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102138837 (ICAM1)
   04091 Lectins [BR:mcf04091]
    102138837 (ICAM1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102138837 (ICAM1)
CD molecules [BR:mcf04090]
 Proteins
  102138837 (ICAM1)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Hyaluronan
  Cell surface receptors
   102138837 (ICAM1)
Lectins [BR:mcf04091]
 I-type lectins (Siglecs)
  102138837 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 ig C2-set_2 Ig_3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 102138837
NCBI-ProteinID: XP_005587991
UniProt: A0A2K5UKF7
Position
19
AA seq 532 aa
MAPSGPQPALPTLVVLLGALLLGPGNAQTSVFPPEVILPRGGSVKVNCSASCDQPISLGM
ETPLPKKEILPGGNNWKMYELSNVQEDSQPMCYSNCPDGQSSAKTLLTVYWTPERVELAP
LPPWQPVGKNLTLRCQVEGGAPRANLTVMLLRGEKELSRQSAVGEPAEVTTTVPVGRDDH
GANFSCRTELDLRPYVLKLFENTSAPHQLQTFDLPATPPQLVSPQVLEVDTQGTVVCSLD
GLFPVSEAQVSLELGDQKLNTTITYGNNSLSAKASVKVTAEKEGTQQLLCGVMLGNQTQE
TRQTVTIYSFPAPNVNLTKPEVSEGTEVIVECEAHPRAKVMLNGVPAQPPGPRAQFLLKA
TPEDNGRSFSCSATLEVAGQLVHKNQTRELRVLYGPRLDEKDCPGNWTWPENSQQTPMCQ
AWGNPLPQLKCLKDGTFPLPIGQSVTVTRDLEGTYLCQARSTRGEVTREVTVNVLSPRYE
VVIIPVVAAAVILGTAGVATYLYNRQRKIRKYRLQQAQNGTPMKPNTQATPP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctcccagcggcccccagcccgcactgcccacactcgtggtcctgctcggggctctg
ctcctaggacctggcaatgcccagacatctgtgttccccccagaagtcatcctgccccgg
ggaggctccgtgaaagtgaattgcagtgcctcctgtgaccagcccatctcgttgggcatg
gagactccgttgcctaaaaaggagatactcccgggtggaaacaactggaagatgtatgaa
ctgagcaatgtgcaggaagatagtcaaccaatgtgctattcaaactgccctgatgggcag
tcatcagctaaaaccctcctcaccgtgtactggactccagaacgggtggaactggcaccc
cttcccccttggcagccggtgggcaagaaccttaccctacgctgccaggtggagggtggg
gcaccccgggccaacctcactgtgatgctgctccgtggggagaaggagctgagccggcag
tcagcggtgggggagcccgccgaggtcacgaccacggtgcccgtgggcagagatgaccac
ggagccaatttctcgtgccgcactgaactggacctgcggccctatgtgctgaagctgttt
gagaacacctcagctcctcaccagctccaaacctttgacctgccagcgactcccccacaa
cttgtcagcccccaggtcctagaggtggacactcaggggaccgtggtctgttccctggac
gggctgttcccagtctcagaggctcaggtctccctggaactgggggaccagaagttgaac
accacaatcacctatggcaacaactccctctcggccaaggcctcagtcaaggtgaccgca
gagaaggagggcacccagcagctgttgtgtggagtaatgctggggaaccagacccaggag
acacggcagacagtgaccatctacagctttccggcacccaacgtgaatctgaccaagcca
gaggtctcagaagggaccgaggtgatagtggagtgtgaggcccaccctagagccaaggtg
atgctgaatggggttccagcccagccaccgggcccgagggcccagttcctgctgaaagcc
accccggaggacaacgggcgcagcttctcctgctctgcaaccctggaggtagccggccag
cttgtacacaagaaccagacccgggagctccgtgtcctgtatggaccccgactggacgag
aaggattgtccgggaaactggacgtggccagaaaattcccagcagactccaatgtgccag
gcttgggggaaccccttgccccagctcaagtgtctaaaggatggcactttcccactgccc
attgggcaatcagtgactgtcactcgggatcttgagggcacctacctctgtcaggccagg
agcactcgaggggaggtcacccgcgaggtgaccgtgaatgtgctctccccccggtatgag
gtggtcatcatccctgtggtagcagccgcagtcatcctgggtactgcaggcgtcgccacg
tacctctacaaccgccagcggaagatcaggaaatacagactacaacaggctcaaaacggc
acccccatgaaaccaaacacgcaagccacgcctccctga

DBGET integrated database retrieval system