KEGG   Macaca fascicularis (crab-eating macaque): 102138971
Entry
102138971         CDS       T02918                                 

Gene name
IL6, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01523  Antifolate resistance
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04218  Cellular senescence
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04657  IL-17 signaling pathway
mcf04659  Th17 cell differentiation
mcf04668  TNF signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05010  Alzheimer disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05143  African trypanosomiasis
mcf05144  Malaria
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05171  Coronavirus disease - COVID-19
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05321  Inflammatory bowel disease
mcf05323  Rheumatoid arthritis
mcf05332  Graft-versus-host disease
mcf05410  Hypertrophic cardiomyopathy
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102138971 (IL6)
   04668 TNF signaling pathway
    102138971 (IL6)
   04066 HIF-1 signaling pathway
    102138971 (IL6)
   04068 FoxO signaling pathway
    102138971 (IL6)
   04151 PI3K-Akt signaling pathway
    102138971 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102138971 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102138971 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102138971 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102138971 (IL6)
   04620 Toll-like receptor signaling pathway
    102138971 (IL6)
   04621 NOD-like receptor signaling pathway
    102138971 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102138971 (IL6)
   04625 C-type lectin receptor signaling pathway
    102138971 (IL6)
   04659 Th17 cell differentiation
    102138971 (IL6)
   04657 IL-17 signaling pathway
    102138971 (IL6)
   04672 Intestinal immune network for IgA production
    102138971 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102138971 (IL6)
   05202 Transcriptional misregulation in cancer
    102138971 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138971 (IL6)
   05161 Hepatitis B
    102138971 (IL6)
   05171 Coronavirus disease - COVID-19
    102138971 (IL6)
   05164 Influenza A
    102138971 (IL6)
   05162 Measles
    102138971 (IL6)
   05168 Herpes simplex virus 1 infection
    102138971 (IL6)
   05163 Human cytomegalovirus infection
    102138971 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138971 (IL6)
   05169 Epstein-Barr virus infection
    102138971 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102138971 (IL6)
   05135 Yersinia infection
    102138971 (IL6)
   05133 Pertussis
    102138971 (IL6)
   05134 Legionellosis
    102138971 (IL6)
   05152 Tuberculosis
    102138971 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102138971 (IL6)
   05144 Malaria
    102138971 (IL6)
   05142 Chagas disease
    102138971 (IL6)
   05143 African trypanosomiasis
    102138971 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102138971 (IL6)
   05321 Inflammatory bowel disease
    102138971 (IL6)
   05332 Graft-versus-host disease
    102138971 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102138971 (IL6)
   05020 Prion disease
    102138971 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102138971 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102138971 (IL6)
   05410 Hypertrophic cardiomyopathy
    102138971 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102138971 (IL6)
   04931 Insulin resistance
    102138971 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102138971 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102138971 (IL6)
   01523 Antifolate resistance
    102138971 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102138971 (IL6)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102138971 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF Phage_int_SAM_1
Other DBs
NCBI-GeneID: 102138971
NCBI-ProteinID: XP_005550059
UniProt: P79341
Position
3
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI
LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccccgccccagtactcccaggagaagattccaaagatgtagcc
gccccacacagccagccactgacctcttcagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaggagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggacacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacaggtttgagagtagtgaggagcaagcc
agagctgtgcaaatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgaaccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtaa

DBGET integrated database retrieval system