KEGG   Macaca fascicularis (crab-eating macaque): 102139631
Entry
102139631         CDS       T02918                                 

Gene name
TNF, Cachectin, TNF-a, TNF-alpha, TNFA, TNFSF2
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01523  Antifolate resistance
mcf04010  MAPK signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04064  NF-kappa B signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04150  mTOR signaling pathway
mcf04210  Apoptosis
mcf04217  Necroptosis
mcf04350  TGF-beta signaling pathway
mcf04380  Osteoclast differentiation
mcf04612  Antigen processing and presentation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04650  Natural killer cell mediated cytotoxicity
mcf04657  IL-17 signaling pathway
mcf04660  T cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04668  TNF signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04930  Type II diabetes mellitus
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04940  Type I diabetes mellitus
mcf05010  Alzheimer disease
mcf05014  Amyotrophic lateral sclerosis
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05143  African trypanosomiasis
mcf05144  Malaria
mcf05145  Toxoplasmosis
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05171  Coronavirus disease - COVID-19
mcf05205  Proteoglycans in cancer
mcf05310  Asthma
mcf05321  Inflammatory bowel disease
mcf05322  Systemic lupus erythematosus
mcf05323  Rheumatoid arthritis
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05410  Hypertrophic cardiomyopathy
mcf05414  Dilated cardiomyopathy
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102139631 (TNF)
   04350 TGF-beta signaling pathway
    102139631 (TNF)
   04064 NF-kappa B signaling pathway
    102139631 (TNF)
   04668 TNF signaling pathway
    102139631 (TNF)
   04071 Sphingolipid signaling pathway
    102139631 (TNF)
   04150 mTOR signaling pathway
    102139631 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102139631 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102139631 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102139631 (TNF)
   04217 Necroptosis
    102139631 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102139631 (TNF)
   04620 Toll-like receptor signaling pathway
    102139631 (TNF)
   04621 NOD-like receptor signaling pathway
    102139631 (TNF)
   04622 RIG-I-like receptor signaling pathway
    102139631 (TNF)
   04625 C-type lectin receptor signaling pathway
    102139631 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    102139631 (TNF)
   04612 Antigen processing and presentation
    102139631 (TNF)
   04660 T cell receptor signaling pathway
    102139631 (TNF)
   04657 IL-17 signaling pathway
    102139631 (TNF)
   04664 Fc epsilon RI signaling pathway
    102139631 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102139631 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102139631 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102139631 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102139631 (TNF)
   05170 Human immunodeficiency virus 1 infection
    102139631 (TNF)
   05161 Hepatitis B
    102139631 (TNF)
   05160 Hepatitis C
    102139631 (TNF)
   05171 Coronavirus disease - COVID-19
    102139631 (TNF)
   05164 Influenza A
    102139631 (TNF)
   05168 Herpes simplex virus 1 infection
    102139631 (TNF)
   05163 Human cytomegalovirus infection
    102139631 (TNF)
   05169 Epstein-Barr virus infection
    102139631 (TNF)
   05165 Human papillomavirus infection
    102139631 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102139631 (TNF)
   05135 Yersinia infection
    102139631 (TNF)
   05133 Pertussis
    102139631 (TNF)
   05134 Legionellosis
    102139631 (TNF)
   05152 Tuberculosis
    102139631 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102139631 (TNF)
   05144 Malaria
    102139631 (TNF)
   05145 Toxoplasmosis
    102139631 (TNF)
   05140 Leishmaniasis
    102139631 (TNF)
   05142 Chagas disease
    102139631 (TNF)
   05143 African trypanosomiasis
    102139631 (TNF)
  09163 Immune disease
   05310 Asthma
    102139631 (TNF)
   05322 Systemic lupus erythematosus
    102139631 (TNF)
   05323 Rheumatoid arthritis
    102139631 (TNF)
   05321 Inflammatory bowel disease
    102139631 (TNF)
   05330 Allograft rejection
    102139631 (TNF)
   05332 Graft-versus-host disease
    102139631 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102139631 (TNF)
   05014 Amyotrophic lateral sclerosis
    102139631 (TNF)
   05020 Prion disease
    102139631 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    102139631 (TNF)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102139631 (TNF)
   05418 Fluid shear stress and atherosclerosis
    102139631 (TNF)
   05410 Hypertrophic cardiomyopathy
    102139631 (TNF)
   05414 Dilated cardiomyopathy
    102139631 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102139631 (TNF)
   04940 Type I diabetes mellitus
    102139631 (TNF)
   04932 Non-alcoholic fatty liver disease
    102139631 (TNF)
   04931 Insulin resistance
    102139631 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102139631 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102139631 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102139631 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102139631 (TNF)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Tumor necrosis fators
   102139631 (TNF)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Cytokines
   102139631 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 102139631
NCBI-ProteinID: NP_001272206
UniProt: P79337
Position
4
AA seq 233 aa
MSTESMIQDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGAATLFCLLHFGVIGPQR
EEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALVANGVELT
DNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcacggaaagcatgatccaggacgtggagctggccgaggaggcgctccccaggaag
acagcagggccccagggctccaggcggtgctggttcctcagcctcttctccttcctgctc
gtggcaggcgccgccacgctcttctgtctgctgcactttggagtgatcggcccccagagg
gaagagttccccaaggacccctctctaatcagccctctggctcaggcagtcagatcatct
tctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcgtggccaatggcgtggagctgaca
gataaccagctggtggtgccatcagaaggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
actccagagggggctgaggccaagccctggtatgagcccatctacctaggaggggtcttt
cagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactatctcgacttt
gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system