KEGG   Macaca fascicularis (crab-eating macaque): 102139775
Entry
102139775         CDS       T02918                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102139775
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102139775
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102139775
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102139775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102139775
   04090 CD molecules [BR:mcf04090]
    102139775
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL3 receptor family
   102139775
CD molecules [BR:mcf04090]
 Proteins
  102139775
SSDB
Other DBs
NCBI-GeneID: 102139775
NCBI-ProteinID: XP_015300236
Position
Un
AA seq 226 aa
SELSQECDSCSPSPSPPPTVDPLPQWTGPLGFRGVSCTLVPERFNPPGNVTVRCNTTHCL
VRWKQPRTYQKLSYLDFQYQLDVHRKNMQPGTENLPINVSGDLENRYNFPSSEPRAKHAV
KIRAADVRILNWSSWSEAAEFGSDDRNPSSVHIYVLLILGTLVCGLLFGFLFKRFFRIQR
LFPPVPQIKDKLNDNHEVEDEIIWEEFMPEEGKGYREEVLTVKEIT
NT seq 683 nt   +upstreamnt  +downstreamnt
gctcagaactgtcacaggagtgtgactcctgctccccgagcccatccccacctcccaccg
tggaccccctgccccagtggacaggacctctggggttcaggggtgtatcctgcaccctcg
ttccagaacgatttaacccgcccggtaacgtcactgtacgctgcaacacgacgcactgcc
tggtacggtggaaacagcccaggacctatcagaagctgtcgtacctggactttcagtacc
agctggacgtccacagaaagaatatgcagcctggcactgaaaacctaccgatcaatgttt
ctggtgatctggaaaatagatacaactttccaagctctgaacccagagcgaaacatgctg
tgaagatcagagctgcagacgtccgcatcctgaactggagttcctggagtgaagccgctg
aatttggctctgacgaccgaaatcccagctctgtgcacatttacgtgctcctgatcctgg
gaacccttgtctgtggccttctcttcggcttcctctttaaaaggttctttaggatacaga
gactgttcccgccagtcccacagatcaaagacaaactgaatgataaccatgaagtggaag
atgagattatctgggaggaattcatgccagaggaaggtaaaggttaccgcgaagaggtgt
tgaccgtgaaggaaattacctga

DBGET integrated database retrieval system