KEGG   Macaca fascicularis (crab-eating macaque): 102140598
Entry
102140598         CDS       T02918                                 

Gene name
DNTT
Definition
(RefSeq) DNA nucleotidylexotransferase
  KO
K00977  DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03450  Non-homologous end-joining
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    102140598 (DNTT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102140598 (DNTT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcf03400]
    102140598 (DNTT)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.31  DNA nucleotidylexotransferase
     102140598 (DNTT)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     102140598 (DNTT)
SSDB
Motif
Pfam: DNA_pol_B_thumb DNA_pol_lambd_f DNA_pol_B_palm HHH_8 NTP_transf_2 BRCT BRCT_2 LIG3_BRCT
Other DBs
NCBI-GeneID: 102140598
NCBI-ProteinID: XP_005566134
UniProt: A0A2K5WHH1
Position
9
AA seq 510 aa
MDPPQTSPLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
FRVENELSDSVTHIVAENNSGSDVLEWLQVQKIQVSSQPELLDVSWLIECIGAGKPVEMT
GKHQLVVRRDYSDSTNPGPPKTLPTAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKCIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDESLKFTRMQRAGFLYYEDLV
SCVTRAEAEAVSVLVKEAVQAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQQ
LLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPLQRVDSDQS
SWQEGKTWKAIRVDLVMCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDK
TKRIFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggatccaccacaaacatcccccttgagccctcggaagaagagaccgcggcagacgggt
gccttgatggcctcctctcctcaagacatcaaatttcaagatttggtcgtcttcattttg
gagaagaaaatgggaaccacccgcagagcgttcctcatggagctggcccgcaggaaaggg
ttcagggttgaaaatgagctcagtgattctgtcacccacattgtagcagagaacaactcg
ggttcagatgttctggagtggcttcaagtacagaaaatacaagttagctcacaaccagaa
ctccttgatgtctcctggctgatagaatgtataggagcagggaaaccggtggagatgaca
ggaaaacaccagcttgttgtgagaagagactattcagatagcaccaatccaggccccccg
aagactctaccaactgctgtacaaaagatctcccagtatgcgtgtcagagaagaaccact
ttaaacaactgtaaccagatattcacggatgcctttgatatactggctgaaaactgtgag
tttagagaaaatgaagactcctgtgtgacatttatgagagcagcttctgtattgaaatct
ctgccattcacaatcatcagtatgaaggacacagaaggaattccctgcctggggtccaag
gtgaagtgtatcatagaggagattattgaagatggagaaagttctgaagttaaagctgtg
ttaaatgatgaacgatatcaatccttcaaactctttacttctgtatttggagtggggttg
aagacttctgagaagtggttcaggatgggtttcagaactctgagtaaagtaaggtcggac
gaaagcctgaaatttacacgaatgcagagagcaggatttctgtattatgaagaccttgtc
agctgtgtgaccagggcagaagcagaggccgtcagtgtgctggttaaagaggctgtccag
gcatttcttccggatgctttcgtcaccatgacaggagggttccggaggggtaagaagatg
gggcatgatgtagattttttaattaccagcccaggatcaacagaggatgaagagcaacaa
cttttacagaaagtgatgaacttatgggaaaagaagggattacttttatattatgacctt
gtggagtcaacatttgaaaagctcaggttgcctagcaggaaagttgatgctttggatcat
tttcaaaagtgctttttgattttcaaattgcctcttcaaagagtggacagtgaccagtcc
agctggcaggagggaaagacctggaaggccatccgtgtggatttagtcatgtgcccctac
gagcgtcgtgccttcgccctgttgggatggactggctcacggcagtttgagagagacctc
cggcgctatgccacacatgaacggaagatgattctggataaccatgctttatatgacaag
accaagaggatattcctcaaagcagaaagtgaagaagaaatttttgcgcatctgggattg
gattatattgaaccatgggaaagaaatgcctag

DBGET integrated database retrieval system