KEGG   Macaca fascicularis (crab-eating macaque): 102141631
Entry
102141631         CDS       T02918                                 

Gene name
CSF1
Definition
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04151  PI3K-Akt signaling pathway
mcf04380  Osteoclast differentiation
mcf04640  Hematopoietic cell lineage
mcf04668  TNF signaling pathway
mcf05010  Alzheimer disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102141631 (CSF1)
   04014 Ras signaling pathway
    102141631 (CSF1)
   04015 Rap1 signaling pathway
    102141631 (CSF1)
   04668 TNF signaling pathway
    102141631 (CSF1)
   04151 PI3K-Akt signaling pathway
    102141631 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102141631 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102141631 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102141631 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102141631 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102141631 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102141631 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102141631 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102141631 (CSF1)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  CSF and other factors
   102141631 (CSF1)
SSDB
Motif
Pfam: CSF-1 DUF6479 CcmH DUF6203 TMEM154
Other DBs
NCBI-GeneID: 102141631
NCBI-ProteinID: XP_015287001
UniProt: A0A2K5TMC4
Position
1
AA seq 587 aa
MLYPEVRGRACSIVGLRPLFFCCEQGMGITGESEGWGEMTPSLSQTWLGSLLLLVCLLAS
RSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLL
VQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEK
VKNVFNETKNLLDKDWNIFSKNCNNSFAECSGQDVVTKPDCNCLYPKAIPSSDPASVSPH
QPLAPSMAPMAGLTWDDSEGTEGSSLLPGEQPLRTVDPGSAKQRPPRSTCQSLEPPETLV
VKDSTIGGLPQPRPSVRAFNTGMEDILDSAMGTNWAPEEASGEASEIPVSQGTELYPSRP
GGGSMQTEPAKPSNFLSASSPLPASAKGQQLADVTGTTLPRVGPMRPTGQDWNHTPQKTD
HPSALLRDPPEPGSPRTSPPRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRD
RRSPAEPEGGPASEGAAGPLARFNSVPLTDTGHERQREGSSSPQLQESVFHLLVPSVILV
LLAVGGLLFYRRRRRSRQEPQRADSPLEQPEGSPLTQDEDRQVELPV
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgctgtatcctgaggtaaggggcagagcctgtagcattgtaggtttgaggcctttgttt
ttctgctgtgagcagggcatggggataactggggagagtgagggctggggagaaatgaca
ccctctctgtcacagacatggctgggctccctgctgttgttggtctgtctcctggcgagc
aggagcatcaccgaggaggtgtcggagtactgtagccacatgattgggagtggacacctg
cagtctctgcagcggctgattgacagtcagatggagacctcgtgccaaattacctttgag
tttgtagaccaggaacagttgaaagatccggtgtgctaccttaagaaggcatttctcctg
gtacaagacataatggaggacaccatgcgcttcagagacaacacccccaatgccatcgcc
attgtgcagctgcaggaactctctttgaggctgaagagctgcttcaccaaggattatgaa
gagcatgacaaggcctgcgtccgaactttctatgagacacctctccagttgctggagaag
gtcaagaatgtctttaatgaaacaaagaatcttcttgacaaggactggaatattttcagc
aagaactgcaacaacagctttgctgaatgctccggccaagatgtggtgaccaagcctgat
tgcaactgcctgtaccccaaagccatccctagcagtgacccggcctctgtctcccctcat
caacccctcgccccctccatggcccctatggctggcttgacctgggatgactctgaggga
actgagggcagctccctcttgcctggtgagcagcccctgcgcacagtggatccaggcagt
gccaagcagcgaccacccaggagcacctgccagagccttgagccgccagagaccctggtt
gtcaaggacagcaccatcggtggcttaccacagcctcgcccctctgtcagggccttcaac
accgggatggaggatattcttgattcggcaatgggcactaactgggccccagaagaagcc
tctggagaggccagtgagattcctgtgtcccaagggacagagctttacccctccaggcca
ggagggggcagcatgcagacagagcccgccaaacccagcaacttcctctcagcatcttct
ccactccctgcatcagcaaagggccaacagctggcagatgtaactggtaccactttgccc
agggtgggccccatgaggcccactggccaggactggaatcacaccccccagaagacagac
catccatctgccctgctgagagaccccccggagccaggctctcccaggacctcaccacca
cgcccccaaggcctcagcaacccctccactctctctgctcagccacagctttccagaagc
cactcctcgggcagcgtgctgccccttggggagctggagggcaggaggagcaccagggat
cggaggagccccgcagagccggaaggaggaccagcaagtgaaggggcagccgggcccctg
gcccgttttaactccgttcctttgactgacacaggccatgagaggcagcgcgagggatcc
tccagcccgcagctccaggagtctgtcttccacctgctggtgcccagtgtcatcctggtc
ttgctggctgtcggaggcctcttgttctacaggcggaggcggcggagccgtcaagagcct
cagagagcggattctcccttggagcagccagaaggcagccccctgactcaggatgaggac
agacaggtggaactgccagtgtag

DBGET integrated database retrieval system