KEGG   Macaca fascicularis (crab-eating macaque): 102143442
Entry
102143442         CDS       T02918                                 

Gene name
CD55
Definition
(RefSeq) CD55 molecule (Cromer blood group)
  KO
K04006  decay accelerating factor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04640  Hematopoietic cell lineage
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102143442 (CD55)
   04610 Complement and coagulation cascades
    102143442 (CD55)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102143442 (CD55)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102143442 (CD55)
   04090 CD molecules [BR:mcf04090]
    102143442 (CD55)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102143442 (CD55)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102143442 (CD55)
  Exosomal proteins of other body fluids (saliva and urine)
   102143442 (CD55)
  Exosomal proteins of colorectal cancer cells
   102143442 (CD55)
CD molecules [BR:mcf04090]
 Proteins
  102143442 (CD55)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102143442 (CD55)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102143442
NCBI-ProteinID: XP_005540740
UniProt: A0A2K5X1U9
Position
1
AA seq 437 aa
MTVARPSVPAALPLLGELPRLLLLLLLLCLPAVWADCGPPPAVPNAQPALKGLTSFPENT
VITYRCDENFMKIPGKQDSVMCLPDSQWSDIEEFCNRSCGAPTRLKFASLKQLYIPQSYF
PVGTVVEYECRPGYRRDPSLLAKLTCLQNLKWSTAAEFCKKKSCPNPGEIPNGQIDTSNG
ILFGAAISFSCNTGYKLFGPTSSLCLVSGSGVQWSDTLPECREIYCPAPPQIDNGIIQGE
REHYGYRQSITYLCNRGFTMIGEHSIYCTVNDDEGEWSGPPPTCRANSLVSKAPPTVQKP
TTVNVRTTEVSPTSQKTTTPNAQATRSTPASRTTKHFHKTTPDKGSGTSSGATHLLSGSH
PVTQAGMRWCIHSSLQSRTPGLKRSFHFSLPSSWYYRVHVFHVDRFAWDASNHGLADLAK
EELRRKYTQLYRLFLVS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgactgtcgcgcggccgagcgtgcccgcggcgctgcccctccttggggagctgccccgg
ctgctgctgctgctgctgctgctgtgcctgccggccgtgtgggctgactgtggccctccc
ccagctgtacctaatgcccagccagctttgaaaggccttacaagttttcccgagaacacc
gtaataacgtacagatgtgatgaaaactttatgaaaattcctggtaagcaggactcagtg
atgtgccttccggacagtcaatggtcagatattgaagagttctgcaatcgtagctgcggt
gcaccaaccaggctaaagtttgcatccctcaaacagctttatatccctcagagttatttt
ccagtcggtactgttgtggaatatgagtgtcgtccaggttacagaagagacccttctcta
ttagcaaaactaacttgccttcagaatttaaaatggtccacagcagctgaattctgtaaa
aagaaatcatgccctaatcctggagaaataccaaatggtcagatcgatacatcaaatggc
atattatttggtgcagccatctccttctcatgtaacacagggtacaaattatttggcccg
acttctagtttatgtcttgtttcaggcagtggagtccagtggagtgacacgttgccagag
tgcagagaaatttattgtccagcaccaccacaaattgacaatggaataattcaaggggaa
cgtgaacattatggatatagacagtctataacgtatttatgtaatagaggattcaccatg
attggagagcactctatttattgtactgtgaatgacgatgaaggagagtggagtggccca
ccacctacatgtagagcaaactctctggtttccaaggccccaccaacagttcagaaacct
accacagtaaatgttcgaactacagaagtctcaccaacttctcagaaaaccaccacacca
aatgctcaagcaacacggagtacacctgcttccaggacaaccaagcattttcataaaaca
accccagataaaggaagtggaaccagttcaggtgctacccatcttctatctgggtctcat
cctgtcacccaggctggtatgcggtggtgtattcatagctcactgcagtctcgaactcct
gggctcaagcgatccttccacttcagcctcccaagtagctggtactacagggtacacgtg
tttcacgttgacaggtttgcttgggacgctagtaaccatgggctggctgacttagccaaa
gaagagttaagaagaaaatacacacaactatacagactgtttctagtctcttag

DBGET integrated database retrieval system