KEGG   Macaca fascicularis (crab-eating macaque): 102143926
Entry
102143926         CDS       T02918                                 

Gene name
IL1R2, IL1RII
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04640  Hematopoietic cell lineage
mcf05146  Amoebiasis
mcf05166  Human T-cell leukemia virus 1 infection
mcf05202  Transcriptional misregulation in cancer
mcf05215  Prostate cancer
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102143926 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102143926 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102143926 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    102143926 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102143926 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102143926 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102143926 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102143926 (IL1R2)
   04090 CD molecules [BR:mcf04090]
    102143926 (IL1R2)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL1 receptor family
   102143926 (IL1R2)
CD molecules [BR:mcf04090]
 Proteins
  102143926 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Izumo-Ig Ig_5
Other DBs
NCBI-GeneID: 102143926
NCBI-ProteinID: NP_001306380
UniProt: Q8HXR7
Position
13
AA seq 394 aa
MFRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYRLWAS
VSPHINLTWHKNDSARMVPGEEETRMWAQDGALWLLPALQEDSGTYICTTRNASYCDKVS
IELRVFENTDASLPFISYPQILTLSTSGVLVCPDLREFTRDKTDVKIQWYKDSLPLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRTVELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHVESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLNMDFKCVVRNTLGFQTLRTTVKEASSTFSWGIVLAPLALA
FLVLGGIWMHRRCKHRTGKADGLTVLRPRHQDFQ
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgttccgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggct
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtggccctgaggtgcccccaggtgccctaccggttgtgggcctct
gtcagcccccacatcaacctgacatggcataaaaatgactctgctaggatggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagcattgcag
gaggactctggcacctacatctgcactactagaaatgcctcttactgtgacaaagtgtcc
attgagctcagagtttttgagaatacagatgcttccctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtgtgccctgacctgagagaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcctttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactggtacatgatgtggccctggaa
gatgcgggctattaccgctgtgtcctgacgtttgcccatgaaggccagcaatacaacatc
actaggactgttgagctacgcatcaagaaaaaaaaagaggagaccattcctgtgatcatt
tcccccctcaagaccatatcggcttctctggggtcgagactgacaatcccgtgtaaggta
tttctgggaaccggcacgcccttaaccaccatgctgtggtggacggccaatgacacccac
gtagagagcgcctacccgggaggccgcgtgaccgaggggccgcgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
aacatggattttaaatgtgttgtccgtaataccctgggttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccacttgcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagcc
gatggtctgactgtgctacggcctcgtcatcaagattttcaataa

KEGG   Macaca fascicularis (crab-eating macaque): 102146317
Entry
102146317         CDS       T02918                                 

Gene name
IL1R1
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04064  NF-kappa B signaling pathway
mcf04380  Osteoclast differentiation
mcf04640  Hematopoietic cell lineage
mcf04659  Th17 cell differentiation
mcf04750  Inflammatory mediator regulation of TRP channels
mcf05146  Amoebiasis
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102146317 (IL1R1)
   04064 NF-kappa B signaling pathway
    102146317 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102146317 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102146317 (IL1R1)
   04659 Th17 cell differentiation
    102146317 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102146317 (IL1R1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102146317 (IL1R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102146317 (IL1R1)
   05163 Human cytomegalovirus infection
    102146317 (IL1R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102146317 (IL1R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102146317 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102146317 (IL1R1)
   04090 CD molecules [BR:mcf04090]
    102146317 (IL1R1)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL1 receptor family
   102146317 (IL1R1)
CD molecules [BR:mcf04090]
 Proteins
  102146317 (IL1R1)
SSDB
Motif
Pfam: TIR Ig_3 Ig_2 I-set Ig_6 ig Ig_5 TIR_2
Other DBs
NCBI-GeneID: 102146317
NCBI-ProteinID: XP_005575209
UniProt: A0A2K5WFG4
Position
13
AA seq 569 aa
MKVLLRLICFIALLISFLEADKCNEREEKIILVSSANEIDVRPCPLNPNEYKGTITWYKN
DSKTPISTEQASRIHQHKKKLWFVPAKVEDSGHYYCVVRNSSYCLRIKITAKFVENEPNL
CYNAEAIFKQRLPVAGDGGLVCPYMEFFKDENNELPKLLWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETIEVDL
GSQIQLICNVTGQLSDTAYWKWNGSFIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
TESRFYKHPFTCLARNTHGMDAAYVQLIYPVTKFQKHMIGICVTLTVIIMCSVFIYKIFK
VDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTAGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIFGRDDYVGEDIVEVINENVKKSRRLIIILVREISGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKRKHGVIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLPSPATKEKLQREAHVPLG
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaaagtgttactccgacttatttgtttcattgctctactgatttcttttctggaggct
gataaatgcaatgaacgtgaagaaaaaataattttagtgtcatctgcaaatgaaattgat
gttcgtccctgtcctcttaacccaaatgaatacaaaggcactataacatggtataaaaat
gacagcaagacacctatatctacagaacaagcctccaggattcatcagcacaaaaagaaa
ctttggtttgttcctgctaaggtagaagattcaggacattactactgtgtggtaagaaat
tcatcttactgcctcagaattaaaataactgcaaaatttgtggagaatgagcctaacttg
tgttataatgcagaagccatatttaagcagagactacccgttgcaggagatggaggactt
gtgtgcccttatatggagttttttaaagacgaaaataatgagttacctaaattactgtgg
tataaggattgcaaacctctacttcttgacaatatacactttagtggagtcaaagatagg
ctcatcgtgatgaatgtggctgaaaagcatagagggaactatacttgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacaaggcctgtgattgtgagcccagctaatgagacaatagaagtagacttg
ggatcccagatacaattgatctgtaatgtcactggccagttgagtgatactgcctactgg
aagtggaatgggtccttcattgatgaagatgacccagtgctaggggaagactattacagt
gtggaaaatcctgcaaacaaaagaaggagtaccctcatcacagtgcttaatatatcagaa
actgaaagtagattttataaacatccatttacctgtttagccaggaatacacatggtatg
gatgcagcatatgtccagttaatatatccagtcactaaattccagaagcacatgattggt
atatgtgtcacattgacagtcataattatgtgttctgttttcatctataaaatcttcaag
gttgacattgtgctttggtacagggattcctgctatgattttctcccaataaaagcttca
gatggaaagacctatgacgcatatatactgtatccaaagacagctggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttttggaagggatgactacgttggggaagacattgttgaggtcatt
aatgaaaacgtaaagaaaagcagaagactgattatcattttagtcagagaaatatcaggc
ttcagctggctgggtggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatccattaaattcattaagcggaaacatggggttatccgctggtcaggggactttaca
caggggccacagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgccagtc
cagcgacggtcaccttcatctaaacaccagttaccgtcaccggccactaaggaaaaactg
caaagagaggctcatgtgcctctcgggtag

DBGET integrated database retrieval system