KEGG   Macaca fascicularis (crab-eating macaque): 102144258
Entry
102144258         CDS       T02918                                 

Gene name
CYP3A8, CYPIIIA8
Definition
(RefSeq) cytochrome P450 3A8-like
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00140  Steroid hormone biosynthesis
mcf00591  Linoleic acid metabolism
mcf00830  Retinol metabolism
mcf00980  Metabolism of xenobiotics by cytochrome P450
mcf00982  Drug metabolism - cytochrome P450
mcf00983  Drug metabolism - other enzymes
mcf01100  Metabolic pathways
mcf04976  Bile secretion
mcf05204  Chemical carcinogenesis - DNA adducts
mcf05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102144258 (CYP3A8)
   00591 Linoleic acid metabolism
    102144258 (CYP3A8)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102144258 (CYP3A8)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102144258 (CYP3A8)
   00982 Drug metabolism - cytochrome P450
    102144258 (CYP3A8)
   00983 Drug metabolism - other enzymes
    102144258 (CYP3A8)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102144258 (CYP3A8)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    102144258 (CYP3A8)
   05207 Chemical carcinogenesis - receptor activation
    102144258 (CYP3A8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcf00199]
    102144258 (CYP3A8)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     102144258 (CYP3A8)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     102144258 (CYP3A8)
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     102144258 (CYP3A8)
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     102144258 (CYP3A8)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     102144258 (CYP3A8)
    1.14.14.-  
     102144258 (CYP3A8)
Cytochrome P450 [BR:mcf00199]
 Cytochrome P450, animal type
  CYP3 family
   102144258 (CYP3A8)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102144258
NCBI-ProteinID: NP_001271463
UniProt: P33268
Position
3
AA seq 503 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNILSYRKGFWTF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFIIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMVV
NETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFS
KKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaatattttgtcctaccgtaagggcttttggacgttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagcgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttatcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtagatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgag
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagaatattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaagctatgct
cttcatcatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaatgacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccactgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system