KEGG   Macaca fascicularis (crab-eating macaque): 102144988
Entry
102144988         CDS       T02918                                 

Gene name
FLT3
Definition
(RefSeq) fms related tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
mcf05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102144988 (FLT3)
   04014 Ras signaling pathway
    102144988 (FLT3)
   04151 PI3K-Akt signaling pathway
    102144988 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102144988 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102144988 (FLT3)
   05202 Transcriptional misregulation in cancer
    102144988 (FLT3)
   05230 Central carbon metabolism in cancer
    102144988 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102144988 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102144988 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102144988 (FLT3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102144988 (FLT3)
Protein kinases [BR:mcf01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102144988 (FLT3)
CD molecules [BR:mcf04090]
 Proteins
  102144988 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_2 Ig_3 I-set Haspin_kinase APH TCAD9
Other DBs
NCBI-GeneID: 102144988
NCBI-ProteinID: XP_005585604
Position
17
AA seq 818 aa
MENQDALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARN
ELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEG
SYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNS
SEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDDGYSVSKFCNHKHQPGE
YIFHAENGDAQFTKMFTLNIRRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCT
EDIPEGVWNRKANRKVFGQWVSSSTLNMSEAMKGFLVKCCAYNSLGTSCETILLNSPGPF
PFIQDSISFYATIGVCLLFIVVLTMLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFR
DCDYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSER
EALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWT
EIFKEHNFSFYPTFQSHPNSSMPGSRDVQIHPHSDPISGLHGNSFHSEDEIEYENQKRLE
EEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARD
IMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVD
ANFYKLIRNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLEDAEEAMY
QNVDGRVSERPHIYQNRRPFSREMDSGPLSPKAQVEDS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggaaaaccaggacgccctggtctgcatatctgagagcgttccagagccgatcgtggaa
tgggtgctttgcgattcacagggggaaagttgtaaagaagaaagtccagcagttgttaaa
aaggaggagaaagtgcttcatgaattatttgggacggacataaggtgctgtgccagaaat
gaactgggcagggaatgcaccaggctgttcacaatagatctaaatcaaactcctcagacc
acattgccacaattatttcttaaagtgggggaacccttatggataaggtgcaaagctgtt
catgtgaaccatggattcgggctcacctgggaattagaaaacaaagcactcgaggagggc
agctactttgagatgagtacctattcaacaaacagaactatgatacggattctgtttgct
tttgtatcatcagtggcaagaaacgacacgggatactacacttgttcctcttcaaagcat
cccagtcaatccgctttggttaccatcgtagaaaagggatttataaatgctaccaattca
agtgaagattatgaaattgaccaatatgaagagttttgtttttccgtcaggtttaaagcc
tacccacaaatcagatgtacatggaccttctctcgaaaatcatttccttgtgagcaaaag
ggtctcgatgacggatacagcgtatccaagttttgcaatcataagcaccagccaggagaa
tatatattccatgcagaaaatggtgatgcccaatttaccaaaatgttcacgctgaatata
agaaggaaacctcaagtgctcgcggaagcatcagcgagtcaggcgtcctgttcctcggat
ggatacccattaccatcttggacctggaagaagtgttcagacaagtctcctaactgcaca
gaagacatcccagaaggagtctggaatagaaaggctaacagaaaagtgtttggacagtgg
gtgtccagcagtactctaaacatgagtgaagccatgaaagggttcctggtcaagtgctgc
gcatacaattcccttggcacatcttgtgagacgatccttttaaactctccaggccccttc
cctttcatccaagacagcatctcattctatgcaacaattggtgtttgtctcctcttcatt
gtcgttttaaccatgctgatttgtcacaagtacaaaaagcaatttaggtatgaaagccag
ctacagatggtacaggtgaccggctcctcagataatgagtacttctacgttgatttcaga
gactgtgactatgatctcaaatgggagtttccaagagaaaatttagagtttgggaaggtg
ctaggatcaggggcttttggaaaagtgatgaacgcaacagcttatggaattagcaaaaca
ggagtctcaatccaggttgcagtcaaaatgctgaaagaaaaagcagacagctctgaaaga
gaggcactcatgtcagaactcaagatgatgacccagctgggaagccacgagaatattgtg
aacctgctgggggcgtgcacgctgtcaggaccaatttacttgatttttgaatattgttgc
tatggtgatcttctcaactatctaagaagtaaaagagaaaaatttcacaggacttggaca
gagattttcaaggaacacaatttcagtttttaccccactttccaatcacatccaaattcc
agcatgcctggttcaagagacgttcagatacacccgcactcggatccaatctcagggctt
catgggaattcatttcactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaa
gaagaggaggacttgaatgtgcttacatttgaagatcttctttgctttgcatatcaagtt
gccaaaggaatggaatttctggaatttaagtcgtgtgttcacagagacctggccgccagg
aacgtgcttgtcacccacgggaaagtggtgaagatatgtgactttggattggctcgagat
atcatgagtgattccaactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatg
gcccctgaaagcctatttgaagggatctataccattaagagtgatgtctggtcatacgga
atattactgtgggaaatcttctcacttggtgtgaatccttaccctggcattccggttgat
gctaacttctacaaactgattcgaaatggatttaaaatggatcagccattttatgctaca
gaagaaatatacattataatgcaatcctgctgggcttttgactcaaggaagcggccatcc
ttccctcatttgacttcatttttaggatgtcagctggaggatgcggaagaagcgatgtat
cagaatgtggatggacgtgtttcggaacgtcctcacatctaccaaaacaggcgacctttc
agcagagagatggattcagggccactctctccaaaggctcaggtcgaagattcatag

DBGET integrated database retrieval system