KEGG   Macaca fascicularis (crab-eating macaque): 102145514
Entry
102145514         CDS       T02918                                 

Gene name
CD19
Definition
(RefSeq) CD19 molecule
  KO
K06465  B-lymphocyte antigen CD19
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04151  PI3K-Akt signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04662  B cell receptor signaling pathway
mcf05169  Epstein-Barr virus infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102145514 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102145514 (CD19)
   04662 B cell receptor signaling pathway
    102145514 (CD19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102145514 (CD19)
  09163 Immune disease
   05340 Primary immunodeficiency
    102145514 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102145514 (CD19)
CD molecules [BR:mcf04090]
 Proteins
  102145514 (CD19)
SSDB
Motif
Pfam: Ig_3 V-set
Other DBs
NCBI-GeneID: 102145514
NCBI-ProteinID: XP_005591597
Position
20
AA seq 574 aa
MPPPCLLFFLLFLTPMEVRPQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEP
FLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDM
WVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWKVPAVTLTY
LIFCLCSLVGILQLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTS
GLGRAQRWAAGLGGTAPSYGNPSSDVQVDGAVGSRSPPGAGPEEEEGEGYEEPDSEEGSE
FYENDSNFGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFL
SPHGSAWDPSREATSLGCTSRALASNSPSPAQAGSQSYEDMRGLLYAAPQLRTIRGQPGP
NHEEDADSYENMDNPDGPDPAWGGGGRMGTWSAR
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgccacctccttgcctcctcttcttcctcctcttcctcacccccatggaagtcaggccc
caggaacctctagtggtgaaggtagaagagggagataacgctgtgctgcagtgcctcgag
gggacctcagatggccccactcagcagctggtctggtgtcgggactccccgtttgaaccc
ttcttaaatctcagcctggggctgccaggcatgggaatccgcatggggcccctgggcatc
tggcttttaatcttcaacgtctctaaccagacggggggcttctacctatgccagccgggg
ctcccctctgagaaggcctggcagcctggctggacagtcagtgtggagggcagcggggag
ctgttccggtggaatgtttcggacctaggtggcctgggctgtggcctgaagaacaggtcc
tcagagggccccagctccccttctgggaaactcaacagctcccaactgtatgtgtgggcc
aaagacagacctgagatgtgggagggagagcctgtgtgtggcccaccgagggacagcctg
aaccagagcctgagccaggacctcaccatggccccgggctccacactctggctgtcctgt
ggggtaccccctgactctgtgtccaggggccccctctcctggacccatgtgcgccccaag
gggcctaagtcctcattgttgagcctagagctgaaggacgatcgcccagacagagatatg
tgggtagtggacacgggtctgttgttgacccgggccacagctcaagacgctgggaagtat
tattgtcaccgtggcaactggaccaagtcattctacctggagatcactgctcggccagca
ctatggcactggctgctgaggattggtggctggaaggtcccagctgtgactttgacttat
ctgatcttctgcctgtgttcccttgtgggcattcttcaacttcaaagagccctggtcctg
aggaggaaaagaaagcgaatgactgaccccaccaggaggttcttcaaagtgacgcctccc
ccaggaagcgggccccagaaccagtatgggaacgtgctatctctccccacacccacctca
ggcctcggacgcgcccagcgttgggccgcaggcctggggggcaccgccccgtcttatgga
aatccaagcagcgacgtccaggtggatggagccgtggggtcccggagccctccgggagcg
ggcccagaagaagaggaaggggagggctatgaggagcccgacagtgaggagggctccgag
ttctatgagaacgactccaactttgggcaggaccagctctcccaggatggcagcggctac
gagaaccctgaggacgagcccctgggtcctgaggatgaagactctttctctaacgctgag
tcttacgagaacgaggatgaagagctgacccagccggtcgccaggacaatggacttcctg
agcccccatgggtcagcctgggaccccagccgggaagcaacttccctgggctgtacttcc
cgtgccctagcctccaattctccatcccccgcccaagcagggtcccagtcctatgaggat
atgagagggctcctgtatgcagccccccagctccgcaccattcggggccagcctggaccc
aatcatgaggaagatgcagactcttacgagaacatggataatcccgatgggccagaccca
gcctggggaggaggcggccgcatgggcacctggagtgccaggtga

DBGET integrated database retrieval system